(data stored in ACNUC7421 zone)

EMBL: FM180568.YLAB

FM180568.YLAB        Location/Qualifiers
FT   CDS_pept        complement(437542..439092)
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="E2348C_0392"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07940"
FT                   /db_xref="GOA:B7UKD8"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKD8"
FT                   /protein_id="CAS07940.1"
FT                   /translation="MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVEISFIEELNTYS
FT                   SRVAIRANKVATQGKDALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVVYIDNNVPQ
FT                   CSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFID
FT                   VIPYSSWQIDAAIIGNAHNVVITSSDKIAQGIITRLQKTPGEHIENNGIIYDILPLPEM
FT                   NISIITWASTKMLQKGWHRQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIEN
FT                   RDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIR
FT                   SVFEDMGDWLRQHSQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTEREF
FT                   ADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL"
     gtgagaacac gacatctggt cggccttatt tcgggagtac tgattctttc agtattgctg        60
     cctgtcggct taagcatctg gctggcccat cagcaggtag aaatatcatt tattgaagag       120
     ctgaatacgt attcctcccg cgtcgctatt cgggccaata aggtggcgac acaagggaaa       180
     gatgcgctgc aagagctgga aagatggcaa ggcgctgcct gtagcgaagc ccatctcatg       240
     gaaatgcgtc gggtatctta cagttatcgc tatattcagg aagtggttta tatcgataac       300
     aacgttcccc aatgttcgtc tctggagcat gaaagcccgc ccgatacctt ccccgagcca       360
     ggtaaaattt cgaaagatgg ttatcgtgtc tggttaacat cgcataacga tttaggcatt       420
     attcgttaca tggtcgccat gggaacggca cattatgtcg tcatgatcga ccccgcttcc       480
     tttattgatg tcattcccta tagctcatgg caaattgatg ccgccattat tggcaatgcc       540
     cataacgttg tcataaccag cagcgataaa attgctcagg gaattattac caggctacaa       600
     aaaacacccg gtgagcatat cgaaaataat ggaatcattt acgatatcct gcccttaccg       660
     gagatgaata tttcgatcat cacctgggct tcaacgaaaa tgttgcagaa aggctggcat       720
     cggcaagtct ttatttggtt accgctcggg ttggtgattg gcctgctggc agcgatgttt       780
     gtgctgcgta ttttgcgccg tatccagtca ccgcatcatc ggctgcagga tgctatcgaa       840
     aatcgtgata tttgcgtgca ctatcagccg attgtctcct tagccaatgg caaaattgtc       900
     ggtgctgagg cactggcgcg ctggccgcag acagacggta gttggttgtc accagatagt       960
     tttattccgc tggcacagca aacgggcctt tctgagccat tgacgctact gattataaga      1020
     agcgtctttg aagatatggg cgactggctg cgtcagcatt ctcagcagca tatttcgatc      1080
     aatcttgaat ccaccgtgct cacctcggaa aaaatcccgc aattgctgcg tgaaatgatc      1140
     aatcactatc aggttaatcc cagacagatc gcgcttgaac tcactgaacg cgagtttgcc      1200
     gatccgaaaa ccagcgcccc gataatttct cgctaccggg aggcgggcca tgaaatttat      1260
     ctcgatgatt ttggtacagg gtattcaagt ttaagctatt tacaggatct ggatgtcgac      1320
     attctgaaga tcgataaatc tttcgttgat gcgctggaat ataaaaatgt cacgccgcat      1380
     atcatcgaaa tggcaaaaac actgaaactg aaaatggttg cggagggaat cgaaaccagt      1440
     aaacaagaag agtggctacg ccagcatggc gtgcactacg gtcagggctg gctctacagc      1500
     aaggcattac cgaaagagga tttcttacgc tgggccgagc aacatttgtg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page