(data stored in ACNUC7421 zone)

EMBL: FM180568.YLBA

FM180568.YLBA        Location/Qualifiers
FT   CDS_pept        complement(501125..501910)
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="E2348C_0448"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07996"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ2"
FT                   /protein_id="CAS07996.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFTLS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYIPVEGHAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
     atgggatatt taaataacgt caccggttac cgcgatgatt tactggctaa ccgtgcgatt        60
     gtgaaacacg gtaatttcgc actgttaaca ccagacggtc tggtaaaaaa tattattccg       120
     ggctttgaaa attgtgacgc gacaatcctc tccacgccaa agctgggtgc ctcttttgtt       180
     gattatctgg tcacactgca tcaaaacggc ggcaaccaac agggcttcgg tggcgaaggc       240
     attgaaacgt tcctgtatgt gatctctgga aatatcactg ccaaagccga agggaaaaca       300
     tttaccttaa gtgaaggtgg ctatctttat tgcccgccag gctccttaat gacgtttgtt       360
     aacgcccagg ccgaagacag ccaaatcttt ttatataagc gtcgctatat tccggtagaa       420
     ggtcatgcgc cgtggctggt ttctggcaat gccagcgaac tggaacgcat tcattatgaa       480
     ggcatggacg atgttattct gctggatttt ctgcccaaag agttaggttt tgatatgaac       540
     atgcatatcc tctcttttgc gccaggtgcc agccatggtt atatcgaaac acacgttcag       600
     gaacacggtg cctatattct ttccggtcag ggggtttata acctcgacaa taactggatc       660
     ccggtgaaaa aaggcgatta catctttatg ggcgcttatt ccttacaggc cggttatggc       720
     gtggggcgtg gtgaagcgtt cagctatatt tactcgaaag attgcaaccg cgacgtagag       780
     atttaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page