(data stored in ACNUC7421 zone)

EMBL: FM180568.YLBE

FM180568.YLBE        Location/Qualifiers
FT   CDS_pept        506221..507480
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="E2348C_0452"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08000"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ6"
FT                   /protein_id="CAS08000.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPSSSLISELNKGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRTLAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIITAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEM
FT                   AEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
     atgtttacat cagtggcgca agccaatgct gcggttatcg aacaaattcg tcgggctcgt        60
     ccacactggc tggatgtgca accgtcttct tcacttatca gcgaactaaa caagggcaaa       120
     acactgcttc acgccgggcc gccaatgcgc tggcaggaga tgaccggacc catgaaaggt       180
     gcatgtgtgg gcgcatgtct gttcgaaggc tgggcgaaag atgaagcgca ggcgctggca       240
     atactggagc agggggaagt gaacttcatt ccttgtcacc atgtgaatgc tgtcgggcca       300
     atgggcggta ttacttctgc cagtatgccg atgctggtgg tcgagaacgt gaccgacggc       360
     aaccgggcgt actgcaacct caacgaaggt atcggcaaag tgatgcgttt tggcgcttac       420
     ggcgaagatg tcctgactcg ccatcgctgg atgcgcgatg tgttaatgcc agtattaagc       480
     gcggcgctgg ggcgcatgga gcgcggtatc gatctcacgg caatgatggc gcagggcatt       540
     accatgggcg atgagttcca tcaacgcaat attgcttcct cagcactgtt aatgcgtacg       600
     ctggccccac aaattgctcg cctcgatcat gataaacagc acattgcgga agtgatggat       660
     ttcctcagcg tgaccgatca gttcttcctc aacctcgcga tggcctactg caaggcggcg       720
     atggatgctg gcgcgatgat ccgcgcaggc agcatcatta cggctatgac ccgcaacggc       780
     aatatgttcg ggattcgggt aagcgggctg ggtgaacgct ggtttactgc gcctgtaaac       840
     actccgcaag gtctgttttt caccggcttc tcgcaggagc aggcgaaccc ggatatgggc       900
     gatagcgcga ttaccgaaac ctttggtatc ggaggtgcgg caatgatcgc agcgcctggc       960
     gtaacgcgct ttgtcggtgc gggtggcatg gaagcggcca gagcggtatc tgaagagatg      1020
     gcggaaattt accttgaacg caatatgcag ttgcagatcc ccggctggga tttccagggt      1080
     gcgtgcctgg ggctggacat tcgtcgcgtg gtagaaaccg gcattacgcc actcatcaat      1140
     accggtatcg cccataaaga ggcggggatc gggcagattg gcgcaggcac cgtgcgggca      1200
     ccgctggcgt gctttgagca ggcgctggaa gcactggctg aaagcatggg gattggttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page