(data stored in ACNUC7421 zone)

EMBL: FM180568.YLBF

FM180568.YLBF        Location/Qualifiers
FT   CDS_pept        507491..508306
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="E2348C_0453"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08001"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKJ7"
FT                   /protein_id="CAS08001.1"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQALAVAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAAAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     atgacgatca tccatcctct acttgccagc cgtagcgcac cgaattatcg ccagtcctgg        60
     cggttagcgg gagtgtggcg gcgggcgatt aacctgatga cggaaagcgg cgaactgtta       120
     acgctgcatc gtcaggggag tggtttcggc cccggcggat gggtgcttcg ccgcgcgcaa       180
     ttcgatgcgt tatgcggtgg attatgcggc aatgaacgac cacaggttgt ggcacaaggg       240
     attcgcctcg ggcgtttcac ggttaaacag ccacagcgtt attgtttgct acgtattacg       300
     ccgcctgcgc atcctcaagc gcttgccgtt gcatggatgc aacgcgcgga ggaaaccggg       360
     cttttcgggc cactggcatt ggcggcaagc gatccgctgc ctgctgaatt acgccagttt       420
     cgtcactgtt ttcaggccgc gctcaatggc gttaagaccg actggcggca ctggctgggt       480
     aaaggccccg gattaacgcc aagtcatgat gacacgctga gcggaatgct gctggcggcc       540
     tggtattatg gcgctttaga tgcgcgctcc ggtcgcccgt tttttgcctg ttccgacaat       600
     cttcaactcg ttaccactgc ggtgagcgtc agttatttac gttatgccgc gcaaggatat       660
     ttcgcctcgc cactcctgca ctttgttcat gctctgagtt gcccgaaacg taccgcagcg       720
     gcgatcgatt cgctgctggc gctggggcat acgtcagggg ccgatacgct gctggggttc       780
     tggcttggcc aacaattatt acaaggaaaa ccatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page