(data stored in ACNUC7421 zone)

EMBL: FM180568.ZITB

FM180568.ZITB        Location/Qualifiers
FT   CDS_pept        complement(697466..698407)
FT                   /transl_table=11
FT                   /gene="zitB"
FT                   /locus_tag="E2348C_0629"
FT                   /product="zinc efflux system protein ZitB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08177"
FT                   /db_xref="GOA:B7ULM5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023500"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULM5"
FT                   /protein_id="CAS08177.1"
FT                   /translation="MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVIGGFLSGSL
FT                   ALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITIL
FT                   IVWEAIERFRTPRPVEGGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGD
FT                   LLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDI
FT                   AELKRRMCREIPEVRNVHHVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQ
FT                   IEHATIQMEYQPCHGPDCHLNRGVSGHSHHHH"
     atggcgcact cacactcaca cacttcctca cacctgccag aagataataa tgctcgtcgc        60
     ttgttgtatg ctttcggcgt gactgccggg tttatgctcg tagaagtcat tggtggtttt       120
     ctttccggtt ctctggcatt gctggccgat gcgggtcata tgttgaccga tactgccgcc       180
     ctgcttttcg ccctactcgc cgtgcaattt tcacgtcgtc ctcccaccat tcgccacact       240
     ttcggttggc taagattgac cacgctcgcg gcgtttgtga atgccatcgc cctggtggta       300
     attaccattt tgattgtctg ggaggcgata gaacgcttcc gcacgccgcg tccggtcgag       360
     ggcggcatga tgatggcaat tgccgtggct gggctgttgg caaatatact ttctttctgg       420
     ttacttcatc acggcagcga agagaaaaac ctcaacgtgc gagcagcggc actgcatgtg       480
     ctcggggacc tgctgggttc ggttggggct attattgccg cgttgattat tatctggacc       540
     ggctggacac ctgctgaccc cattctctca atactggtgt cgcttctggt tctgcgtagc       600
     gcgtggagac tgttgaaaga tagtgtgaat gaattacttg aaggtgcacc ggtatcgctg       660
     gatatcgctg aactgaagcg tcgcatgtgc cgggaaatcc cggaagtccg caatgtgcac       720
     catgtgcatg tatggatggt aggcgagaag ccggtgatga cgctgcatgt gcaggtgatc       780
     ccgccacacg atcacgatgc cttgttggat cagatccaac actacctgat ggatcactat       840
     cagattgagc acgccaccat tcagatggaa tatcaacctt gtcatgggcc agactgccac       900
     ctgaatagag gggtgtctgg ccattcacat catcatcatt aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page