(data stored in SCRATCH zone)

EMBL: FM954973.PE120

FM954973.PE120       Location/Qualifiers
FT   CDS_pept        134418..135626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0123"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25394"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25394.1"
FT                   /translation="MESLSLAQAQKMVLLSQKLPPKKLPSKKQRNGGALANTLSAIENL
FT                   GYVQIDTISVIQRAHHHTLWNRNQDYQLNHLDKLLERREVFEYWSHAAAYLPMRDFRFS
FT                   LHRKNGFASGKLKHWYKKDDALMAHVLKRIESEGPLMAKDFEGDRLNPGGWGGKPAKQA
FT                   LEILFMQGDLMVPSRVNFHKVYDLTERVLPSDIDTSEPTEQEYIEHLITRYLEANGVGI
FT                   ASEMSYLLKNTKPLIQTTLQQMLEDKQLMKVDIQGSDYYVLPGAFDLLNQPLSRTKLKI
FT                   LSPFDNLLIQRKRMQSLFNFDYLLECYVPEAKRQFGYFSLPILWQGGLVARMDCKVDRK
FT                   SGLLNIRNLVVEDRVKTHESLIYALCEELKHFMVFNQCDEMIVHNTTPSEFGKRLMSYW
FT                   QTV"
     atggaatcat tgtcactcgc tcaagcgcaa aaaatggtat tgctttcgca aaaactgcca        60
     cctaagaagc tgccctcaaa gaaacaacgt aatgggggcg ctttggcgaa tacgctgtct       120
     gcgattgaaa accttggcta tgtgcaaatt gataccatct ctgtgattca gcgagcacac       180
     catcatacgc tgtggaatcg caatcaagac taccaactga accatcttga taagctgcta       240
     gagcgtcgag aggtgtttga gtattggtcg catgccgccg catatttacc catgcgtgac       300
     ttccgtttca gcttgcatcg aaagaacggg tttgcgagcg gtaagcttaa gcattggtat       360
     aaaaaggatg atgcactgat ggcgcatgtt ctcaaacgca ttgagagcga agggccatta       420
     atggcgaaag actttgaagg ggatagacta aaccctggcg gatggggtgg caaacctgcc       480
     aagcaggcgc tagagatttt gtttatgcaa ggtgacttaa tggtgccgag ccgagtgaac       540
     ttccataagg tgtatgacct aaccgagcga gttttgccga gtgacattga tacctcagaa       600
     ccaacggaac aagagtacat cgagcatcta attacgcgtt atttagaagc taatggtgtg       660
     ggaatagcgt cggaaatgag ctatctactc aagaacacaa aacctctgat tcagacaaca       720
     ctccagcaga tgcttgaaga taagcagttg atgaaagtag atattcaagg ctctgattac       780
     tatgttctgc caggtgcttt tgatctgctg aatcaacctc tttccagaac caagcttaag       840
     atactgtctc cgtttgataa cttgctgatt caacgaaagc gaatgcaatc attgttcaac       900
     tttgattacc ttcttgagtg ctatgttcca gaagctaagc gtcagtttgg ttattttagc       960
     ttaccgattc tctggcaagg tgggctggtg gcacgaatgg attgtaaggt cgataggaag      1020
     agtggtttgc tcaatattcg taacttggtt gttgaagata gagttaaaac tcatgagtca      1080
     ttgatttacg ctttgtgcga agaactaaag cacttcatgg tgttcaacca atgtgatgag      1140
     atgatcgtcc ataacaccac accttctgag tttggtaaac gcttgatgag ctattggcaa      1200
     acagtctag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page