(data stored in SCRATCH zone)

EMBL: FM954973.PE126

FM954973.PE126       Location/Qualifiers
FT   CDS_pept        140862..143009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0129"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25404.1"
FT                   /translation="MLPGQHEAGVDLSGSPLSANAVIDWEIANSDLVFGSYADKTDNKR
FT                   STTIGYMYNQKLELNSGWLENDLRNNAELHGVNFEDFFLHFSEDTVLAEVDNTHGENTL
FT                   LSGKPMILGYTASEDHAGFWLYQEPPWDADVFENFEQDGALYVYHAEQFERLTFKFSQF
FT                   AVSGEFWIEYPTAIDSHGRVSQWERLDVKKDKTLNMTRNQSVIWNLPGNWVRATTHDGS
FT                   GVSYGGGQYFGSTFLREGGRLYVVRVRWQSENADDRPRLKEVKLKNSFPTVKLTDAPTT
FT                   TPDGNAISQWRNIRGFDVSADLNGDNYLSPSEYRNRTNKNATARFRWESRVVPFGRMWS
FT                   ANSSWSLTNVANADYLSAIHRYYKQSWASQGLDGAYNDDTNKLIGSNQFYVHSGGHVQE
FT                   LGAVAGSNQADDLYKQQFSAFLQNLSVLESDASIGLNIGTANLLGRNGQSHLSEAGSLY
FT                   LREHYIFPSTGFSGYSGISKFWDNSALAYNGQRVIFQATTRYGRVQYLGNSEENWKKDQ
FT                   YSTLAIYHLNRHAQHSYFNQWNNSYVYGSDNTTADIFWQSGVPKNIAYQPSSLLAVDLG
FT                   EPSHQVLQGFEPIPLMLSTTTPQPTDYTIVGDSSMSEVVHADLPNGMTHVLPTFTYFMY
FT                   QSKNQVAAGGPEDMVLAREFSNGRVLYRTDFHGKNSSFYEAEKLMIVLDVPMKPVDENG
FT                   NIGEYVTEIHIGGYEGLFLLY"
     gtgctgccag ggcaacatga agctggtgtt gatctttcgg gctccccatt gtctgcgaat        60
     gccgtcattg attgggaaat tgcgaacagt gacctcgtat ttggctctta tgcagataaa       120
     accgacaata agcgatctac gacaattggg tatatgtata accaaaaatt ggagctcaat       180
     tctggttggt tggagaacga ccttcgtaat aacgcagaat tacatggcgt taattttgaa       240
     gacttctttc tccatttttc tgaagataca gtgctcgcag aagttgataa cacccacggt       300
     gaaaatactc tcttaagtgg aaagcctatg atcttgggct atacagccag tgaagatcat       360
     gcgggctttt ggctgtatca agagcctcct tgggatgctg atgtgtttga gaatttcgaa       420
     caggacgggg ctttgtatgt ctatcatgct gaacagttcg aacgtctgac ctttaagttc       480
     tcacagtttg ctgtcagcgg cgaattctgg attgaatacc caacagctat tgactctcac       540
     ggaagggttt cacagtggga aaggctcgat gtaaagaaag acaaaacgct caatatgacc       600
     agaaaccaat cggtgatttg gaaccttccg ggtaactggg taagagccac aactcatgat       660
     ggcagtgggg tgagttatgg tggcggccag tattttggtt caaccttttt gagagagggt       720
     ggccgtttat acgttgtgag agttcgttgg caaagtgaga acgctgacga caggccgcgt       780
     ttaaaagaag taaaactcaa aaacagcttt ccaaccgtta agttaaccga cgctccgacc       840
     acaacgcctg atggcaatgc tatcagccaa tggcgaaata ttcgtggctt tgacgtgtct       900
     gcagacctga atggcgataa ctacttgtcg ccaagcgagt atcgaaatcg aaccaataag       960
     aatgcgacag cgcgttttcg ttgggaatca agagtggtgc catttggtcg aatgtggagc      1020
     gcgaattcat cttggtcgtt aacgaacgtc gcaaacgcgg attatttatc ggccattcat      1080
     cgctactaca agcaaagctg ggcaagccaa ggtttggatg gtgcatacaa cgacgacaca      1140
     aataaactca ttggctcgaa ccagttctat gtccattctg gcggacatgt tcaagagtta      1200
     ggagctgttg cgggttcaaa tcaagcggat gatctctaca aacaacaatt ttcagcgttt      1260
     ctccaaaatc tatctgtttt agaaagtgat gcgtctattg ggttgaacat tggtacggcg      1320
     aacttgctgg gtcgaaatgg gcagtctcat cttagcgaag ccgggtcttt gtatctgaga      1380
     gagcattaca tttttccgtc tactggattt agtggttact cggggatctc taagttctgg      1440
     gataattctg cgctcgccta caatggacaa agagttattt ttcaggcgac aacgcgttac      1500
     gggcgagtcc aatatctagg aaatagtgaa gagaattgga agaaagacca atactcgacc      1560
     ctagcgattt accacctcaa tcgacatgct caacacagct attttaatca gtggaacaat      1620
     agttacgtct atgggagtga taacacgact gcagacattt tctggcaaag tggtgtccct      1680
     aaaaatatcg cttatcaacc aagttcgtta ttagccgttg atttgggaga gccgagtcat      1740
     caggtcctac agggatttga gccaattcct ttgatgctat cgacaacgac acctcaaccc      1800
     acagactaca ccatcgttgg tgattcatcg atgagtgaag tggtgcatgc tgatctgcct      1860
     aatggtatga ctcacgttct acctacgttc acgtacttta tgtatcaatc taaaaatcag      1920
     gtggccgcgg gtggccctga agatatggtg ttagcgagag agttcagcaa tggtcgtgtg      1980
     ttgtatcgca cggatttcca cggtaagaat tcgagctttt atgaggcaga gaagctgatg      2040
     attgtattgg acgtgccgat gaagcctgtc gatgaaaacg gcaacatcgg agagtatgtg      2100
     actgaaattc atattggcgg ttatgaaggg ctgttcttgc tttattaa                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page