(data stored in SCRATCH zone)

EMBL: FM954973.PE140

FM954973.PE140       Location/Qualifiers
FT   CDS_pept        complement(152443..153417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0143"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25428"
FT                   /db_xref="GOA:B7VQB3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25428.1"
FT                   /translation="MKTLLKLTLLASTIAMSSSAFAATTLKLAHAAPESDLQQDLSLFF
FT                   KKEVEARSNGEIKVNIYPQGQLGSDKQMIDGSRAGIVDLAMVGLNNYNGLMPESAAFTL
FT                   PFMFPDRQTAYKVLDGEPGKEVLANFEKFGLKGLGFPENGYRNMTNNEKPIRVPSDVEG
FT                   LQMRVNGSKALNDMFNELGANPQQLPVSELYTALETGVVDSQDHPISVTLSFKFDEVQK
FT                   YLSLTQHAYSPLVLTMNLRKFDKLTEDEQKIIEEVSAEAVAMQRELSIQKEDKMIAQLE
FT                   ANGMQVNRDVDGAAFQQAIQPVWSAYIEKNGDVMINKIKLAAK"
     atgaaaaccc tactaaaact tactctactc gcttcgacta tcgcaatgag ctctagcgct        60
     tttgccgcta caactctaaa actggcgcac gctgcaccag agtcggattt gcaacaagac       120
     ctatctttgt tctttaagaa agaagtagaa gctcgttcaa acggcgaaat caaagtaaac       180
     atctacccac aaggtcaatt gggcagtgat aagcaaatga tcgatggttc acgtgctggc       240
     atcgtcgatt tagcgatggt tggcttgaac aactacaacg gcctaatgcc tgaatcagcg       300
     gccttcactc tgccgttcat gttcccagat cgtcaaacag catacaaagt actggacggc       360
     gagccgggta aagaagtgtt agcgaacttt gaaaaattcg gtcttaaagg tcttggtttc       420
     cctgaaaatg gttaccgcaa catgaccaac aacgaaaaac ctattcgtgt tccttcagat       480
     gttgaaggcc tacaaatgcg tgtgaatggc tcgaaagcgc taaacgacat gttcaatgag       540
     ctcggtgcta acccgcagca gcttccagta tctgaacttt atactgcact tgaaacaggc       600
     gttgttgact ctcaagacca cccaatttct gtaacgctgt ctttcaagtt tgatgaagta       660
     caaaaatacc taagccttac acaacatgct tactcaccat tagttctaac aatgaaccta       720
     cgtaagttcg acaagctaac tgaagatgag caaaagatta tcgaagaagt ttctgctgaa       780
     gccgtagcaa tgcaacgtga gctaagcatc cagaaagaag acaagatgat tgctcaacta       840
     gaagcaaacg gcatgcaagt aaaccgtgac gttgatggtg ctgctttcca acaagctatc       900
     caaccagttt ggagcgctta catcgagaaa aatggcgatg tgatgatcaa caagatcaaa       960
     ctagcagcta agtaa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page