(data stored in SCRATCH zone)

EMBL: FM954973.PE16

FM954973.PE16        Location/Qualifiers
FT   CDS_pept        22448..23272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0018"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25204"
FT                   /db_xref="GOA:B7VPY9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B7VPY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25204.1"
FT                   /translation="MPKPLPFPNLDLSPLGLTGPRPAEIITLPSHMDCHDHHYSQVVIG
FT                   LKGQAEFEVSGKGNLVGPGQGCVVTASSDHAFGGVVGQSDILVLNMPVPTDDDPLMLEK
FT                   INQLESSNVYFQLDAQIQKLIHMLVQEMQASPNDLLLSRACNDTVIALMQRHISAFETS
FT                   IKDSRFDLEALDRYIEQHLANKISVAQLAGSVFLGESQFHMLFKDQMGITPHQYVLGKR
FT                   IDRSRRLIEQGNLSLGQVAELAGFSGQSSFTHTFSRLQGMSPSQYKKKISVK"
     atgccaaaac ctttaccctt tccaaaccta gacttgtctc cgctagggct tacaggcccc        60
     cgaccagcgg aaatcataac tttgccttcg catatggact gtcacgatca tcattattcg       120
     caggtggtga ttggtttaaa aggtcaggct gaatttgaag tgagcggtaa aggtaatctt       180
     gtcggcccag gtcaaggttg tgtggtaacg gcgagctctg atcatgcttt cggtggtgtg       240
     gttggccagt cggacatcct agtactcaat atgccagtgc caacggatga tgaccctctg       300
     atgctagaga agatcaatca gttagaatca tcgaacgtct acttccaatt agacgcgcaa       360
     attcaaaagc ttatccatat gttggtgcaa gaaatgcagg cgagtcctaa tgatctgcta       420
     ctaagccgag cctgtaatga cacagtgatc gcgctgatgc aaagacacat ctcggcattc       480
     gaaacctcaa tcaaagattc acgctttgat cttgaagcgt tggatcgcta catagaacag       540
     catttagcaa ataagatctc cgtcgcgcag cttgcgggta gtgtgttctt gggtgaaagc       600
     cagttccaca tgctattcaa agatcaaatg ggtattactc cgcatcagta cgtgttaggt       660
     aagcgtatcg accgatctcg tcgtttaatc gaacaaggta acctcagcct tggtcaggtc       720
     gctgaactgg ctggtttctc cggtcaatct tcctttactc acaccttttc acgccttcaa       780
     ggcatgtcac catctcaata caaaaagaaa atttctgtta aatag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page