(data stored in SCRATCH zone)

EMBL: FM954973.PE181

FM954973.PE181       Location/Qualifiers
FT   CDS_pept        210088..212268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0185"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25506"
FT                   /db_xref="GOA:B7VQF4"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25506.1"
FT                   /translation="MKEQTVLKQVAEMANIADSYVSAWGDEAQVSEETITSLLASLGYD
FT                   TSSDDALLKSAERKHRKDVLDPVLVLRDGEPVEVTLNLGVSARESEFSWRLETEQGEVL
FT                   EGYLQSQVVRDERAEGGPLVFALPSDLAWGYHKLIVSRKRRKKPYEMTLIITPKACFKQ
FT                   SPIEQGKKLWGPSVQLYTLRTQHNWGIGDFGDLKQLVSDIASRGGDFVGLNPIHSLFPA
FT                   NPEGASPYSPSSRRWLNVLYIDVSSVPEFALSAEAQQTVGSAEFQQRLQKAREAHWVNY
FT                   TEVSELKMSILPLLFAEFKTRHLDKNSDRAQAFLAFVEEGGESLMHQAAFDALHGELHA
FT                   EDSGMWGWPVFPEKFRTFESPATQKYIKDNLDQVHLYMYLQWLADCQINDAQSLAEEKG
FT                   MVVGLYRDLAVGVADSGSETWADEGNLVMDASIGAPPDILGPLGQNWGLPPLNPEVLQE
FT                   TGYDAYIKLLRANMKHCGALRIDHVLGLLRLWWIPKGENATKGAYIYYPVQDMLSILAL
FT                   ESHRYQCSVIGEDLGTVPDEIVDILADAGVHSYKVFFFETSENDGGFISPKHYASQSMA
FT                   ALCTHDMPTLRGFWHCDDLKMGQEIGLYPDAQQLETLFDNRLECKQGILDSVAWHGFLP
FT                   EGVGRDASQVPMDSYLAEALQLHVAAGGSTLLSVQLEDWLEMDKPVNIPGTVDEYPNWR
FT                   RKLSMNLDEIFAHEGVNRIASKLTDVREKAAK"
     atgaaagaac agaccgtatt aaaacaagtc gcagaaatgg caaatattgc cgatagttac        60
     gttagtgcgt ggggcgatga agcacaagta tcagaagaga cgattacgtc tctattggct       120
     tcattgggct acgatacaag cagcgatgat gcactgctta aatctgcaga aagaaagcac       180
     agaaaagatg tactagaccc ggttcttgtc ttgcgtgacg gtgagccagt agaagtgaca       240
     ctcaatctgg gtgtgagtgc tcgtgaaagt gagttcagct ggcgcttaga aaccgagcaa       300
     ggagaggtac ttgaaggcta tcttcaatct caagtcgttc gtgacgagcg tgccgagggt       360
     ggccctttag tgtttgcatt gccaagtgat ttggcatggg gttatcacaa gctcattgtg       420
     agtcgtaagc gccgtaagaa accttacgag atgacgttga ttattacgcc caaagcatgc       480
     ttcaagcagt cacccattga gcaaggcaaa aagctttggg gaccaagtgt tcaactgtac       540
     acgctaagaa ctcagcacaa ctggggtatt ggtgatttcg gtgacctaaa acagcttgtt       600
     tcggatatcg cgtctcgcgg tggtgacttt gttggtctaa acccaattca ctcactgttc       660
     cctgcaaacc cggaaggtgc gagcccatac agcccgtctt cacgtcgttg gttgaacgta       720
     ttatacattg atgtgagttc agttcctgag ttcgcattaa gcgcggaagc gcaacaaacg       780
     gtaggcagcg ccgagttcca gcagcgccta cagaaagctc gtgaagcgca ctgggtgaat       840
     tacactgaag tgtctgagct gaagatgagc atcttacctc tgctattcgc agaatttaag       900
     actcgtcatc tagacaaaaa cagcgaccgc gcacaagcgt tcttagcgtt cgttgaagag       960
     ggcggtgaaa gcctgatgca tcaagccgcg tttgatgctc tgcacggtga actgcatgct      1020
     gaagattcag gtatgtgggg ctggcctgta ttcccagaga aattccgtac atttgaaagc      1080
     cctgcgaccc agaaatacat caaagataac ctagatcaag tgcatctcta catgtaccta      1140
     caatggttag ccgattgcca aatcaacgat gcacagtctc ttgctgaaga gaaaggcatg      1200
     gtggttggac tgtaccgtga cttagcggta ggcgttgcag attcaggcag cgagacatgg      1260
     gctgatgaag gcaacctagt gatggatgcg agcattggtg ctccaccgga tattcttggt      1320
     cctctaggcc aaaactgggg cttaccgcca ctaaacccag aagtacttca agaaaccggc      1380
     tacgacgctt acatcaaact acttcgtgcc aacatgaagc actgtggtgc attgcgtatt      1440
     gaccatgttt taggtctgct gcgtttgtgg tggattccaa agggtgagaa cgcaacgaaa      1500
     ggtgcgtaca tctactaccc agtgcaagac atgctgtcta ttctggcgct tgaatctcac      1560
     cgttaccaat gcagcgttat cggtgaagat ttagggacgg taccggatga aatcgtagac      1620
     atccttgctg atgctggcgt gcattcttac aaagtcttct tcttcgaaac atcagaaaat      1680
     gacggtggtt ttatttctcc gaagcactac gcgtcacaat cgatggcagc actgtgtact      1740
     cacgatatgc caacgcttcg cggcttctgg cactgtgatg acttgaaaat gggtcaagag      1800
     attggtttat acccagacgc acaacagcta gaaactttgt tcgataaccg cttggagtgc      1860
     aagcaaggta tcttagactc agtggcatgg cacggcttcc taccagaagg tgttgggcgt      1920
     gatgcaagtc aagtaccgat ggattcttat cttgctgaag cgcttcagtt gcacgttgcg      1980
     gctggtggct caacactcct gagtgttcag ttggaagatt ggctagagat ggataagccc      2040
     gttaacatcc ctggtacggt cgatgagtac cctaactggc gtcgtaaact atcaatgaac      2100
     ttggacgaaa tcttcgctca tgaaggcgtg aatcgtatcg cctctaagct aactgacgta      2160
     cgagaaaaag cagctaaata a                                                2181
//

If you have problems or comments...

PBIL Back to PBIL home page