(data stored in SCRATCH zone)

EMBL: FM954973.PE195

FM954973.PE195       Location/Qualifiers
FT   CDS_pept        complement(227951..228283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0199"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25531"
FT                   /db_xref="GOA:B7VQG8"
FT                   /db_xref="InterPro:IPR006817"
FT                   /db_xref="InterPro:IPR016367"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25531.1"
FT                   /translation="MKRLYDKECIAHLLMINKQGVLMNKTLIAAAASVFILAGCSSEPE
FT                   EAAMSQMDQLTNQVAELTSEVEALKGDKAAAEMKAQEAAAAAMAAKEEADRANDRIDNI
FT                   AESYTK"
     atgaagcgac tatatgataa agaatgtata gcgcatcttt tgatgataaa taagcaagga        60
     gttcttatga ataagacgtt aatcgcagct gcagcctcag ttttcatttt agctggttgt       120
     tcttctgagc cagaagaagc tgcaatgtca caaatggatc aattgactaa ccaagttgct       180
     gagctaacca gtgaagttga agcacttaaa ggcgataaag cggcagctga aatgaaagct       240
     caagaagcag ctgcagccgc tatggcagca aaagaagaag cggatcgtgc taacgaccgt       300
     atcgacaaca tcgcagagtc ttacactaaa tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page