(data stored in SCRATCH zone)

EMBL: FM954973.PE202

FM954973.PE202       Location/Qualifiers
FT   CDS_pept        236943..237872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0206"
FT                   /product="ABC transporter: Transmembrane protein; phosphate
FT                   uptake"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in another organism; PubMedId :
FT                   8760913; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25544"
FT                   /db_xref="GOA:B7VQH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25544.1"
FT                   /translation="MTIATNSEQLMNSEATQLKRGLRKKKRVDWKERIFHGLFLTSAII
FT                   GIVSLAVIAFFIVRESIPAFQEAGLSGIVLGQNWLPPALYGVATMIVASVVSTLGAVVV
FT                   GVPIGVLTAIFIAEIAPKRLADIIRPAVELLAGIPSVVYGFFGLVIIVPLIQNVFQVPA
FT                   GNTILAGIIVLGVMILPTVITVSETSIRAVPRTYKEGSLALGASKIFTIFKLLVPAARS
FT                   GIMTGVILGIGRALGETMAIIMVMGNAPAMPEGILDSARTLTANIAIEMSYASGIHASA
FT                   LYATGVVLLVFIMSLNAILLYLNREKAR"
     atgaccatcg caacgaatag tgaacagctt atgaatagcg aagcgactca actgaaacgc        60
     ggcttacgta aaaagaagcg tgtagattgg aaagagcgta tttttcacgg cttatttctt       120
     actagcgcaa tcatcggcat cgtatccctt gctgttattg cttttttcat cgttagagaa       180
     agtatccctg cgttccagga agcgggccta tcgggcatcg tgctaggaca gaactggcta       240
     ccaccagcac tttacggtgt tgcaaccatg attgtggcat ctgtcgtatc gacattaggc       300
     gcggtagtgg ttggtgtgcc gattggtgta ttaacggcaa tctttattgc tgaaatcgcg       360
     ccaaagcgtc tggcggacat cattcgtcct gctgtcgaat tgctagcggg tattccttcg       420
     gtagtttacg gcttcttcgg cctcgttatt atcgttcccc tgattcaaaa cgtatttcaa       480
     gtgcctgcgg gtaacacgat tttggcgggt attattgttc tgggtgtgat gatccttccg       540
     acggtaatta cggtttctga aacctcaatc cgtgctgtac caagaacgta caaagaaggt       600
     tctttagcgt taggtgcttc aaagatcttt actatcttta agttgctcgt tccggctgct       660
     cgctcaggca ttatgacggg cgtaattttg ggtattggcc gtgctcttgg tgaaacgatg       720
     gcaatcatta tggtgatggg taatgcacct gcaatgcctg aaggtatctt agattcagct       780
     cgtacactaa ccgcgaacat tgcgattgaa atgtcttacg cgagtggtat tcacgcaagt       840
     gcgctctatg cgacgggtgt tgttctcctt gttttcatca tgtctctgaa tgcaattctc       900
     ctttacttga accgtgagaa ggcgaggtaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page