(data stored in SCRATCH zone)

EMBL: FM954973.PE214

FM954973.PE214       Location/Qualifiers
FT   CDS_pept        251958..252053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25565"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25565.1"
FT                   /translation="MASSIKQVIRQFTKLFTTIGIKVEQAYIFIG"
     ttggccagtt caataaaaca agtgatacgc caattcacta agttatttac tacgattggt        60
     attaaagttg agcaagccta tatctttatc ggttag                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page