(data stored in SCRATCH zone)

EMBL: FM954973.PE240

FM954973.PE240       Location/Qualifiers
FT   CDS_pept        complement(279767..280903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0244"
FT                   /product="ABC transporter: Type C secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25610"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25610.1"
FT                   /translation="MMNRAISVFVLTLGILLLLGCDESTQPSAQNMGSILGAETQTENE
FT                   TAIDQAQFSPVVKGIEITFPADHQAHPNFRHEWWYLTANLIDEDGNALGVQWTQFRFAA
FT                   APQGSGNSTKETTWQSQQIYMAHSAVTTKDKHYADEKWSRDQAELAGVSTSPFRVYLDD
FT                   WQWNSSSDDLFPATLDANSDQFGYSLKLTSNAPYQKQGVQGYSTKSSDGKVASYYYSQP
FT                   FINVSGEVAIDGVTHLVSGKGWIDREWSSQFLLDSQQGWDWFALRLSDETSLVVFQLRN
FT                   STTGKASYSHARLMKQNGSSIAIKQQDIRLTAIKQTEIDGRDYPTEWQVSIPTQQIELT
FT                   VSALNPEAKMPLSVPYWEGPIVIEGTHSGTGYMELTGY"
     gtgatgaatc gagcaataag cgttttcgtt ctcacacttg gcatcttgct ccttttaggg        60
     tgcgacgagt ccactcaacc atcagctcaa aatatgggtt cgatacttgg cgcagaaaca       120
     caaaccgaga atgaaacggc aatcgatcaa gcgcaatttt ctccggtagt aaaaggtatc       180
     gagatcacct tccctgccga ccatcaagca caccctaatt ttcgtcatga atggtggtac       240
     ttaaccgcaa acttaattga tgaagacggc aatgcgttag gcgtacagtg gacacaattc       300
     cgcttcgcgg ctgcaccaca gggaagtggc aatagcacta aggaaactac gtggcaaagt       360
     cagcaaatct acatggcaca cagcgcagtc accactaaag ataagcacta cgccgatgaa       420
     aagtggtcac gtgaccaagc tgaactggcg ggtgtcagca cttccccatt tcgtgtctat       480
     cttgatgact ggcaatggaa ctcttcaagc gatgatctat tccccgcaac cttggacgct       540
     aattcagatc agtttggcta ctcgcttaag ttaaccagca acgcgcctta tcaaaagcaa       600
     ggcgtacaag gctacagcac taaaagtagc gatggcaaag tggcttccta ctactacagc       660
     caaccattca ttaatgtatc gggcgaggta gctattgatg gagtaaccca tctggtttct       720
     ggcaaaggtt ggatagacag agaatggagc tctcagtttt tactcgactc gcaacaaggt       780
     tgggattggt ttgcgctaag gctgagtgat gaaaccagct tggtggtatt tcaacttcga       840
     aactcaacaa caggcaaagc cagttattcc catgcaaggc tgatgaaaca aaatggctct       900
     agcatcgcga ttaagcagca agacatccgc ttaaccgcta tcaagcaaac agaaatcgac       960
     ggacgcgatt atccaacaga atggcaagtt tcgattccaa ctcaacaaat cgaactgacc      1020
     gtctcggcac tcaatccaga agcaaaaatg ccactgtctg taccctattg ggaagggcca      1080
     atcgttattg aaggaacaca ctctggtacg ggctatatgg agttgactgg gtattaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page