(data stored in SCRATCH zone)

EMBL: FM954973.PE246

FM954973.PE246       Location/Qualifiers
FT   CDS_pept        289034..289309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0251"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25621"
FT                   /db_xref="GOA:B7VQL9"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25621.1"
FT                   /translation="MNVPEVMSKWKTLLALTMALFALKFHLLLIWGLFCWFWGWENLRA
FT                   KEAFFVERIELKEHPVLFTLIIISWFVMGGVYFYMDNRVFEFFSSL"
     atgaacgtgc ctgaagtaat gtctaagtgg aaaacattgc tggctctgac catggccttg        60
     tttgctctta agtttcatct acttctgatt tgggggctat tttgctggtt ttggggatgg       120
     gaaaatcttc gcgcaaaaga agccttcttt gttgaacgta ttgagctaaa agaacatcca       180
     gttttgttta ccttaatcat catcagttgg tttgtgatgg gaggggtata tttctatatg       240
     gacaatagag tctttgagtt ttttagctct ttgtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page