(data stored in SCRATCH zone)

EMBL: FM954973.PE251

FM954973.PE251       Location/Qualifiers
FT   CDS_pept        complement(293136..294467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0256"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25630"
FT                   /db_xref="GOA:B7VQM4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25630.1"
FT                   /translation="MTLKEILNIPNVRYFLMFRSSYFARFYYPIFTLLYLDYGLTLSQF
FT                   AMLNVVWAATIVLAEVPSGAFADTLGRKKLVVLSSIVMFVEIAMIALVPTGNPDLVFIV
FT                   FLINRILSGLAMALASGADEALAYDTLKEQGNEELWPRVLQIQLRVASTVGIFVTLIGA
FT                   AMYDVNFMANIFHFLGLSEPESTKDLMRIPVFATLFVAMIAIYAAINMREEKKVMPSDQ
FT                   TKLATTIASLKLTADTGKWVLATPYVLFMLLYYSLFEHTSRMFLTMNSQYYLAIDIPII
FT                   YFGFIGAGISLLKIILAGQSRRLAESMEPKTFIVVMGLASMATYYWISLGWTIYGVIPA
FT                   LVLIFIIMTMNIFISYHLNKKTESHNRATVLSFKGLMFNLGYGLIGILYAYYYKLVSQG
FT                   YTEQEIEQNLAFLASLSSFFYYFTLLFVLISALFYFKNKKQPIF"
     atgacgctca aagagatcct taacattccc aatgtccgct acttcttaat gtttagaagc        60
     agctactttg cgcgttttta ctaccctata ttcaccctac tttatttaga ttacgggtta       120
     accctgtctc aattcgcgat gctcaatgta gtttgggcgg ccaccattgt gcttgctgaa       180
     gtaccgtcgg gtgcattcgc cgatacctta ggccgcaaga aactggtggt gctgtcttcg       240
     attgtgatgt ttgttgagat cgccatgata gcgctagtac caaccggaaa ccccgacttg       300
     gtattcatag tctttctaat taaccggatt ctcagtggct tagcgatggc actggccagc       360
     ggtgctgacg aggcattggc ttacgacacc ttaaaagaac aaggcaatga agagttgtgg       420
     ccgcgagtgc tgcaaattca gcttcgtgtc gcctcaacgg tcggtatctt tgtcacacta       480
     attggcgcgg cgatgtacga cgtgaacttt atggcgaaca tctttcattt ccttggactg       540
     tctgaaccag aaagcactaa agatctgatg cgtattcctg tgttcgccac cctatttgta       600
     gcgatgatcg ccatctatgc cgcgattaat atgcgcgaag agaaaaaggt aatgccaagc       660
     gaccaaacca aattggcaac caccatcgcc agccttaaat taacagctga cacaggtaag       720
     tgggtacttg ctacgcctta cgtgctgttc atgttgttgt attacagcct gttcgaacac       780
     acctcaagaa tgttcctaac catgaacagc caatattatc tcgccatcga tattcctatt       840
     atctacttcg gttttattgg cgcggggatc agtttgctta aaatcatatt ggcggggcaa       900
     agccgtaggc tagcagaaag catggagcct aaaaccttca ttgtggttat gggtttagca       960
     agcatggcga cttattattg gatcagttta ggttggacga tttacggggt tattccagca      1020
     ctagtgctga tttttattat catgacgatg aacattttca ttagctacca cctgaataaa      1080
     aaaaccgaat cacacaaccg agccactgtc ctcagcttta aaggcctgat gtttaatctc      1140
     ggatatgggc tgatcggcat tttgtacgct tactactata aactggtgtc tcagggctac      1200
     accgaacaag aaatagaaca gaacctcgct ttcttagctt cactgtcttc gtttttctat      1260
     tacttcacct tattgttcgt tttgattagc gcgttgttct atttcaaaaa caaaaaacag      1320
     ccgatctttt ga                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page