(data stored in SCRATCH zone)

EMBL: FM954973.PE266

FM954973.PE266       Location/Qualifiers
FT   CDS_pept        complement(314963..316180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0271"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25654"
FT                   /db_xref="GOA:B7VQN9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25654.1"
FT                   /translation="MTLDLDIRTLCLIMVFLSGTYCIGLVIKQQSQARILGMRSFFCAI
FT                   FLLMVGFSLLSFGSHISPWLSKITSNMAIAGGFASMVFSLTQLRQSPSLYSVCVFLGLP
FT                   VVIVTLIYFTLYDASTNARVITMSFYITLCTVASVLVIKTGTVADVKAALVLLMSVFSA
FT                   HSIFMLVRIWITLKEPNIDDFLQASSIHQLAFIITAILLSTIGFTYNWLLNARLMQSLY
FT                   SSSMKDSLTQLYNRRAMNEMLRREWMRSVRHNHPLSVIILDIDHFKQVNDQHGHQTGDQ
FT                   VLKKIGIILQHNLRAADIPFRYGGEEFLIVLPDTRIGEACKVAEKLRIIIEETKFWRQQ
FT                   SANLTASFGLSELWAEDKVPSMIKRADEALYYAKENGRNTVCALTDEQGKLTKQDLPSL
FT                   ASPVQH"
     atgactctag acttagatat tcgaactttg tgtttaatta tggtgttttt gtctggtacg        60
     tactgtatcg gtctagtaat caaacaacaa agccaagctc gtattctggg aatgcgcagt       120
     tttttctgtg ccatattttt attaatggta gggttttcat tactgagttt tggctcccac       180
     atttcacctt ggctctcaaa aataacatca aatatggcaa tagccggcgg attcgcttca       240
     atggtgttta gcctgactca attaagacaa tcgccctcgc tctatagcgt ttgcgttttc       300
     ttgggattac cagtcgtcat cgttaccttg atttacttca ccctctacga tgcatcaacc       360
     aatgcgagag tgataacgat gagtttttat atcacgttat gtactgtggc cagtgtattg       420
     gtcataaaaa caggcactgt cgctgatgtc aaagcagcgc ttgtactatt gatgagtgta       480
     ttcagtgctc actctatttt catgctagtt aggatctgga taacccttaa ggaacctaat       540
     attgacgact ttttacaagc aagtagcatc catcaacttg cgttcatcat aactgctatt       600
     ttgcttagca cgatcggctt cacttacaac tggcttctaa acgccagatt gatgcaatca       660
     ctttatagct catcaatgaa agacagctta acccagttgt ataatcgccg cgctatgaat       720
     gaaatgttaa gacgagaatg gatgcgcagc gtaaggcata atcacccctt atcggtgatc       780
     attctcgata tcgaccactt taaacaggtc aacgatcaac atggtcacca gactggcgat       840
     caagtattga aaaaaatagg catcattctc caacacaacc ttagagccgc agatataccg       900
     ttccgctatg gcggcgaaga gttcttgatt gtattgcctg atacccgtat cggtgaagca       960
     tgtaaggtag ctgagaagtt acgaataatt atcgaagaga ccaagttttg gcgacagcaa      1020
     agtgccaatc tgacagcaag ttttgggctg tctgaacttt gggctgaaga caaggttccc      1080
     agtatgatta aacgcgcgga tgaagcctta tattacgcaa aagaaaatgg tcgaaatacg      1140
     gtctgtgctt taactgatga gcaaggaaaa ttgacaaagc aggacttacc ttcccttgct      1200
     tcaccagtgc aacactag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page