(data stored in SCRATCH zone)

EMBL: FM954973.PE267

FM954973.PE267       Location/Qualifiers
FT   CDS_pept        complement(316352..317380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0272"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25656"
FT                   /db_xref="GOA:B7VQP0"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="CAV25656.1"
FT                   /translation="MTQLTITRPDDWHVHLRDGEVLKDTVRDISRYNGRALIMPNTIPP
FT                   VTDTEMALAYRERIMAEQPSEQFQPLMALYLTDNTTPDEIRKAKESGAVVAAKLYPAGA
FT                   TTNSDSGVTSAQKIYHVLEAMQEVGMLLLVHGEVTAHDVDIFDREKEFLDTVLAPIVND
FT                   FPNLKIVLEHITTADAATFVKNANENVAATITAHHLLYNRNHMLVGGIKPHFYCLPILK
FT                   RNTHQLALIEAATSGSKKFFLGTDSAPHAKGAKESACGCAGSYTAHAAVELYAEVFDLE
FT                   GKIENLEAFASHNGPDFYGMPRNADTITLVKEEWNVAETMPFGSDIVVPIRGGETIAWA
FT                   VK"
     atgacacaac ttacgattac tcgtcctgac gactggcacg ttcatctacg cgatggcgaa        60
     gtattaaaag atacagtccg cgatatcagc cgctacaatg gtcgagcgtt aatcatgcca       120
     aacaccatcc caccggtaac cgataccgaa atggctcttg cttaccgtga acgcatcatg       180
     gcagagcagc caagtgaaca gttccagcct ctaatggcac tttacctaac agacaacaca       240
     acacctgatg aaattcgcaa agcgaaagaa tctggcgctg ttgtagcggc gaagctatac       300
     cctgctggcg caacgacaaa ctcggattca ggtgtaactt cagctcaaaa gatctaccac       360
     gtactagaag cgatgcaaga agtgggtatg ttgctgctgg tacacggtga agtaacggct       420
     cacgatgttg atatctttga ccgtgaaaaa gagttcctag acacggttct agcaccgatt       480
     gttaacgact tccctaatct gaagatcgtt ctagagcaca tcacgactgc agatgcagcg       540
     actttcgtta agaacgctaa cgagaacgtc gcggcaacca tcacagctca ccacttgctt       600
     tacaaccgta accacatgct ggttggcggc attaagccac atttctactg cctacctatc       660
     cttaagcgca acacacacca gttagcactt atcgaagcgg caacaagcgg tagcaagaag       720
     ttcttcttgg gtaccgattc tgcgccacac gcgaaaggcg ctaaagagtc agcatgtggt       780
     tgtgcaggtt cttacacagc acacgctgcg gttgaactgt acgctgaagt attcgattta       840
     gaaggcaaga ttgagaactt ggaagcgttt gcaagccaca atggtccgga tttctacggc       900
     atgccacgta atgcagacac aatcacgctc gttaaagaag agtggaatgt tgctgaaacc       960
     atgcctttcg gttcagacat cgttgtgcca atccgtggcg gcgagacgat tgcttgggct      1020
     gtaaaatag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page