(data stored in SCRATCH zone)

EMBL: FM954973.PE281

FM954973.PE281       Location/Qualifiers
FT   CDS_pept        complement(328699..329589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0286"
FT                   /product="hemin ABC transporter, periplasmic hemin-binding
FT                   protein HutB"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25681"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25681.1"
FT                   /translation="MKDLKVLNKLKNNKHLLAIAAMGLVLAAPIANADDAKQPRIISAG
FT                   SAVTELVLALGAEEQLIAIDVTSHLPQSKTLPKIGYHRNLSAEGLIALSPTTLIGSDEM
FT                   GPDNAISQLKSVGIDVEIVNTEANVEGLLKRIDQIAKITHTEAHSQQVKAEVNQKIAAL
FT                   KANQVPNNEAKKVLFLLLHEGRPANVAGGETSPNAIIELAGGVNPAAKSLTSYKPLSME
FT                   SLVEMQPDVILVSGRSYQKIGGADAILKSLPMLAATPAGMNKQIITVKGSALVGGLGLE
FT                   SLSEAKRINALIYPL"
     atgaaagact taaaagtgct caataaatta aagaacaaca aacatttact cgcaatcgcc        60
     gcgatggggt tggtacttgc agcacctatc gccaatgctg acgacgcaaa acaacctaga       120
     atcatcagtg ctggcagcgc agttaccgaa ttagttcttg ctctgggtgc tgaagagcag       180
     ttgattgcaa ttgatgtgac cagtcactta cctcaatcaa aaacgctacc aaagattggt       240
     taccaccgaa acctttctgc agaagggttg attgccttat cgccaaccac actgattggc       300
     tcagatgaga tggggccaga caacgccatt tctcaattaa aatctgtggg tatcgatgtc       360
     gagatcgtta acaccgaagc aaacgttgaa gggctactaa agcgtatcga ccaaattgca       420
     aagattaccc ataccgaagc tcactcacag caagtgaaag ccgaagtgaa tcaaaaaatt       480
     gcggcactga aagctaacca agtacccaac aacgaagcga agaaagttct gttcctatta       540
     ctgcatgaag gccgtcctgc aaatgttgct ggcggtgaaa catcacccaa cgcgatcatt       600
     gaattggctg gtggtgttaa ccctgcggct aaaagcctga cctcttacaa accactgtcg       660
     atggaatcac tcgttgaaat gcagcctgat gtcatcttag tgagcggccg tagctaccag       720
     aaaataggcg gcgctgatgc cattcttaaa tcgttaccta tgctagcggc aacgccagca       780
     ggcatgaaca agcaaatcat taccgtaaag ggcagcgctc tagttggagg gcttggtctt       840
     gaaagcctct ctgaagcgaa gcgaataaac gcacttatct acccgctata a                891
//

If you have problems or comments...

PBIL Back to PBIL home page