(data stored in SCRATCH zone)

EMBL: FM954973.PE305

FM954973.PE305       Location/Qualifiers
FT   CDS_pept        complement(352866..353861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0310"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25722"
FT                   /db_xref="GOA:B7VQS8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25722.1"
FT                   /translation="MIMKKAVLASAVVAALVSGSSLAATVYSSDGTELKIGGRAEFRGD
FT                   FIGSGGAEVEGSMKDKTRFRLNLGGKTELTDTATAFGFYEAEQDTGSDKFENRYMYAGV
FT                   DFDGQAVSVGRQDMASVIVSDFTDITEFSGVQQAFGAASDKEDGVFAYRGGFDALQLEA
FT                   TYQTNSKKDSDGYGISGVYSLPMGLDLGLAYSGEDLGENKGSADQILAGLAYSLDNLYL
FT                   AATYSTGDLDDKATGTDAKSFTAMEFAAQYKFTKQVSAAVVYTYQEDEINSGAKVDAVD
FT                   GIELAGYYKLNSNFRTYLSYYVNGLDEVKNAKGIVTAGEDTLRLGVRYDF"
     gtgattatga aaaaggcagt tctagcttct gcagtggtag cggcactagt ttcaggttca        60
     tcgttagcag caacggttta cagctctgat ggtacagaac ttaaaattgg cggtcgtgca       120
     gaattccgtg gtgatttcat tggttctggt ggtgctgaag ttgaaggttc aatgaaagat       180
     aaaactcgtt tccgtttaaa tcttggtggt aaaacagaac ttacagatac tgcaacggca       240
     ttcggtttct acgaagcaga gcaagacaca ggttctgata agtttgaaaa ccgttacatg       300
     tacgcaggtg ttgattttga cggccaagcc gtttctgtcg gtcgccaaga tatggcttca       360
     gttatcgtat ctgactttac agatatcact gagttttctg gtgtgcagca agcattcggt       420
     gcagcttctg ataaagaaga tggtgtattt gcataccgtg gcggctttga tgccctgcaa       480
     ctagaagcca cttaccaaac caacagcaaa aaagactccg acggctacgg catttctggt       540
     gtttactcac tgccaatggg cttagatctt ggcctagcct actcaggtga agacctaggg       600
     gaaaataaag gtagcgcaga ccaaatcctt gccggcctag cgtattctct agacaacctg       660
     tacttagctg caacttattc aacaggcgac ctagatgata aagcgacagg taccgatgct       720
     aagtcattca ctgctatgga atttgcagcg caatacaaat tcaccaagca agtatctgct       780
     gcagtcgtat atacttacca agaagatgaa atcaacagcg gagcaaaagt agacgctgtc       840
     gacggtattg aattagctgg ttactacaaa ctaaacagca atttccgcac atacctttct       900
     tactacgtta acggtttaga cgaagttaaa aatgcaaaag gtatcgtgac agctggtgaa       960
     gacacacttc gcctaggtgt ccgctacgat ttctaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page