(data stored in SCRATCH zone)

EMBL: FM954973.PE315

FM954973.PE315       Location/Qualifiers
FT   CDS_pept        362826..364181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0320"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25739"
FT                   /db_xref="GOA:B7VQT8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25739.1"
FT                   /translation="MPSGSSKQWPAKLLSLLFFLVVMSAIEFFHSKELSYLKDESYSEA
FT                   KKQLSIIRSRIEAAIVSDMYILNNLSTLVTINPDGDMKSWNKIAENIIRDGFHIRLIGL
FT                   AEDDILNFVYPMEGNEQILGIDYRDHPTQWESVEIARNIGNTVIAGPFELFQGGQAIIT
FT                   RTPIFRDPPFNQDYWGVSSAVISLDELFEDVGIGILENKYKLAIRGANSSGKDGAVFYG
FT                   SQDVFDNAFVTEQVSFPYGGWYLALSGNEHVLMDVQWYRIQAVRLVGYTIMLMLAFAFF
FT                   TIYRLYRIADSRSMHDELTMLPNRRYFMYSLKQAFKVTQKQRARTFAVVNIDLDGFKAI
FT                   NDTFGHAAGDQVLIECANRIKSELRGSDIVARIGGDEFLVLLPRIIDDQHVSSIVAKLR
FT                   RAICSTPVVYDTHSIYLRISVGWVIHNNNYSDVDALLKAADEKMYEQKRQIL"
     atgccaagtg gttctagcaa gcaatggcct gccaaattat tatctttact gtttttttta        60
     gtggtaatga gtgctatcga gttttttcac tctaaagagt tatcctacct gaaagatgaa       120
     tcctactctg aggcaaaaaa gcagttatcg atcattcgtt ctcgaataga agccgcgatc       180
     gtgtcagata tgtatatcct caataatttg tctactcttg tgacgataaa tcctgacggc       240
     gatatgaaga gttggaacaa gatcgctgag aatatcattc gagatggatt ccacattcgt       300
     ctgattggtc tggctgaaga tgacatccta aatttcgtat acccaatgga aggcaatgag       360
     cagattcttg gtatagatta tcgagatcat ccaacccaat gggagtcggt tgaaattgcc       420
     agaaatattg gcaacaccgt tattgctggt ccttttgagc tgtttcaagg tggtcaagct       480
     atcattacgc gaactccgat ctttcgagac ccgcctttta accaagacta ttggggtgta       540
     tccagtgccg ttattagttt agatgagctg tttgaagatg tcggaattgg gatactcgaa       600
     aacaagtata aactcgcgat tcgtggtgca aacagttcgg gtaaagatgg cgcggtcttt       660
     tatggctctc aggacgtatt tgataatgct tttgtgactg aacaggtgag cttcccatac       720
     ggtggttggt accttgctct ctctggtaat gagcatgtgt tgatggatgt gcagtggtat       780
     cgaattcaag cagtaaggtt ggtaggttac accataatgt taatgctggc gtttgccttc       840
     tttactattt atcgcctgta ccgaattgca gatagtcgct ctatgcatga tgaactcacc       900
     atgttaccta atcgtcgata ctttatgtac agcctaaagc aggcgttcaa agtcacccaa       960
     aagcagagag caagaacctt tgctgtggta aatatcgatc ttgatggctt taaagcgatc      1020
     aatgatactt ttgggcatgc ggctggcgat caggtgctta ttgagtgtgc taatcgcatt      1080
     aagagcgagt tacgtggttc agatatcgtt gcgagaatcg gtggtgatga gttcttagtt      1140
     ttgttaccac gtattattga tgatcaacat gtatcgtcga ttgtagctaa acttcgaaga      1200
     gcgatatgta gcacacctgt tgtttatgat acgcactcga tttatcttcg aattagcgtt      1260
     ggttgggtaa ttcataacaa taactacagt gatgtcgatg cactactcaa agcagctgat      1320
     gaaaaaatgt acgaacagaa acgacaaatt ttatag                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page