(data stored in SCRATCH zone)

EMBL: FM954973.PE317

FM954973.PE317       Location/Qualifiers
FT   CDS_pept        complement(366620..368185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0323"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25742"
FT                   /db_xref="GOA:B7VQU0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022055"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25742.1"
FT                   /translation="MHTISQQKFYNVNFTNMALSKSLVRQSHFLGTKIRNLRKRNHLTM
FT                   EDLSARCIRINPEYAPSVSYLSMIERGKRVPSIDMLEVIAQVFQKNPTWFLDDESEQQA
FT                   IAPDKGNRGGISGMALEPSFLFSNDILQIAIPEMLSQTGISGRQFAHLLIRAHQESNQN
FT                   HFPDLERAAEEVGLKRLNLSVEDLIDIARSLGINIRWVTRTPKDVVDELGINAKQLVTS
FT                   FFEPPSTIFLNEILKEYPTRLKYDLSVYIGHCILHSKEGLKSVLSVGNNNTWDDNQVSG
FT                   SSQLNSQDILQAWRDFESSFFAGALLCPKVPFRQLLDRTGYEIDVHKRAGVSPSVAMRR
FT                   MTVVSPYPHWHYFDAYGPGKLKAVYRGNGIPLPWGNMRTVADPCQHWAVFRRLSEPRAG
FT                   SSAQISILNVGDEPRIYCCESINMTDPAGNNRVLCAGIDLNPAIDAQGGNSRDIAEQLK
FT                   ASCVNNGGSVVIPRNIKKDLTTIAKILNINWIERGIETEARLICSRGGECPRQPSCYSK
FT                   CGEC"
     ttgcatacaa tttcacaaca aaaattttac aatgtgaatt ttacaaatat ggccttgtca        60
     aaaagtttag ttcgtcagtc tcatttccta ggtacgaaaa tacgtaacct aagaaaacgt       120
     aaccatttaa cgatggaaga tctgtctgcg cgttgtatta gaatcaaccc agaatacgca       180
     ccttccgttt cttacctttc aatgattgaa cgtggaaagc gcgtcccaag catcgatatg       240
     ctagaagtaa tcgcgcaggt ctttcagaag aacccaacct ggttccttga cgacgaatct       300
     gaacaacaag ccattgctcc tgataaaggg aatcgtggtg ggataagtgg catggcactc       360
     gagcctagct ttcttttctc caacgacatc ctgcaaattg caattccaga gatgctatct       420
     caaacgggga tctcaggccg ccagtttgca cacctcttaa ttcgagcaca ccaagaaagc       480
     aatcagaacc acttccctga ccttgagcgc gcagcggaag aagttggctt aaaacgtctt       540
     aacctcagcg tagaagatct gatagacatc gctagaagcc taggaattaa catccgttgg       600
     gtaacacgca caccgaaaga cgttgttgat gaactcggaa ttaatgccaa acagctagtc       660
     acttcgttct ttgaacctcc tagcacaatc ttcttaaacg aaatcctgaa agagtacccc       720
     actcgtctga aatacgattt atcggtctat attggccatt gtattctgca tagcaaagaa       780
     ggcttaaaga gtgtgttgtc ggtcggcaac aacaacacat gggacgacaa ccaggtttca       840
     ggctcttcgc aacttaattc tcaagatatt cttcaagcat ggcgagactt tgaatctagc       900
     ttctttgctg gcgcacttct ttgccccaaa gttccattta gacagttgct tgaccgcact       960
     ggttacgaaa tcgacgttca caaaagagcg ggggtttccc cctctgttgc tatgcgtcga      1020
     atgacggtag tatcgcccta ccctcactgg cactactttg atgcttatgg gccagggaaa      1080
     ctcaaggcgg tgtaccgcgg gaacgggatt ccactgcctt ggggaaatat gagaactgtt      1140
     gccgacccat gtcaacattg ggctgtgttc cgtcgattgt cagaacctcg cgcagggagt      1200
     tcggctcaaa tatctatttt aaatgtgggt gatgaaccaa gaatctactg ctgtgaatcc      1260
     atcaatatga cggatcctgc aggtaacaat cgcgtattgt gtgctggcat agaccttaac      1320
     cctgcgattg atgcacaagg cggtaattca agagacattg cagagcaact taaagcatca      1380
     tgcgttaaca atggtggctc ggtggtaatc ccgcgtaaca tcaagaaaga tctcacgaca      1440
     atagccaaga ttctaaatat aaattggatt gaacgtggga ttgagacaga ggctaggctt      1500
     atctgctccc gaggtggaga atgcccgcgc caaccaagct gttactcaaa gtgtggtgag      1560
     tgttag                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page