(data stored in SCRATCH zone)

EMBL: FM954973.PE337

FM954973.PE337       Location/Qualifiers
FT   CDS_pept        385873..387534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0344"
FT                   /product="Hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25777"
FT                   /db_xref="GOA:B7VQW0"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7VQW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="CAV25777.1"
FT                   /translation="MFCIQCEQTIQTPTVKGCSFAQGMCGKTSEVSDLQDVLVHSLQGV
FT                   SFWASLGRACDVIDTEVDEWAPKAFFATLTNVNFDPARIIEFAQQSHEFKQRLEQKVRA
FT                   AATLIGFEIPELSAAAQFDLPTDSSELLALAPQAAVNRGHDSQHEDVIGLRLLCLYGLK
FT                   GAAAYMEHARVLGQTDDAIFAEYHEIMAFLGTDPSDLKQLLDTSMQIGLMNYKVMEMLD
FT                   KGETDTFGHPQPTTVNVKTKKGHCILVSGHDLHDLEKILQQTEGKGINVYTNGEMLPAH
FT                   GYPELNKYPHLAGNYGSAWQNQQKEFANFPGAIVMTSNCLLNPDVGSYADRLFTRSIVG
FT                   WPGVDHLEGDDFSAVIDCALAQEGFKHDEIEQMITVGFGRNALMEAAPAVVEQVKEGNI
FT                   KHFFLVGGCDGDKSERSYYTDFTAQAPEDSVILTLACGKFRFNKNQFGDINGIPRLLDV
FT                   GQCNDAYSAIQLAIALSQEFDCGINELPLTLVLSWFEQKAIVILLTLFALGVKGIYTGP
FT                   TAPAFLTENLLKIMQDEFDMRSISTPEQDLKTILAA"
     atgttctgta ttcaatgtga acaaacaatt caaaccccaa ccgtaaaagg ctgttctttc        60
     gcacaaggca tgtgtggaaa aacctcggaa gtatccgacc ttcaagacgt gttggtgcat       120
     tctcttcaag gcgtttcttt ttgggcaagc ttaggtcgcg cttgcgatgt tattgataca       180
     gaagttgatg agtgggcgcc aaaagcgttc ttcgcaacac tgactaacgt taacttcgac       240
     cctgctcgta ttatcgaatt cgcacaacag tctcatgaat tcaagcagcg tttagagcaa       300
     aaagttcgtg cagcagcaac attgattggt tttgaaattc cagagctttc tgcagcagca       360
     cagttcgatc ttccaacaga ttcttcagag ctattggcac ttgcgcctca agctgctgta       420
     aaccgtggtc acgattctca acacgaagat gtgattggtc ttcgtcttct ttgcctatac       480
     ggcttaaaag gtgcggcagc ctacatggag cacgctcgtg ttcttggtca aactgatgac       540
     gctatttttg ctgaatacca tgaaatcatg gcgttcctag gtacagatcc atccgatcta       600
     aaacagttac ttgatacatc aatgcagatt ggcttgatga actacaaagt aatggaaatg       660
     ctagacaaag gcgagacaga tacctttggt caccctcaac caacaaccgt gaatgtgaag       720
     actaaaaaag gtcactgtat tcttgtttct ggtcacgact tacatgatct agaaaagatt       780
     cttcaacaaa ctgaaggcaa gggcatcaac gtttacacta acggtgagat gctaccagca       840
     cacggttacc cagagctaaa caagtaccca caccttgcgg gtaactacgg cagcgcttgg       900
     cagaaccagc aaaaagaatt cgctaacttc cctggcgcaa ttgtaatgac gtctaactgc       960
     ctgcttaacc ctgatgtagg ttcttacgca gaccgtctat ttacacgcag catcgtgggc      1020
     tggccgggtg ttgatcacct tgaaggcgac gatttcagcg cagtaattga ttgtgcacta      1080
     gcgcaagaag gtttcaaaca cgacgagatc gagcaaatga tcactgtcgg ttttggtcgt      1140
     aacgcgctga tggaagcggc acctgcggtt gttgagcaag tgaaagaagg caacatcaaa      1200
     cacttcttcc tagtgggtgg ttgtgacggt gacaaatctg aacgtagtta ctacacagac      1260
     ttcacagctc aagcgccaga agattcagta atcctgacat tggcatgtgg taaattccgt      1320
     ttcaacaaaa accaattcgg cgacattaac ggtatcccac gtctgttaga tgttggccaa      1380
     tgtaacgatg cttactctgc gattcagctt gctatcgcac tgtctcaaga gtttgattgt      1440
     ggtatcaacg aacttccgtt aacgctggtt ctatcttggt tcgagcaaaa agcgatcgtt      1500
     atcttgctta ctctgttcgc tctaggtgtg aaaggtatct acacaggccc tacagcacct      1560
     gcgttcctaa ctgaaaacct acttaagatt atgcaagacg agttcgatat gcgttctatt      1620
     tcaacgccag agcaagatct taaaacaatc ttagcggctt aa                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page