(data stored in SCRATCH zone)

EMBL: FM954973.PE338

FM954973.PE338       Location/Qualifiers
FT   CDS_pept        387647..388726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0345"
FT                   /product="putative ferredoxin oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25779"
FT                   /db_xref="GOA:B7VQW1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25779.1"
FT                   /translation="MYAWSDSDSINLVCLKKWHETPDTVSFELGSIPQDLHFNFKPGQF
FT                   ITLGLDMPTKTDYRAYSVASCPEDNRLKLTVKRVEGGLVSNFIVDELDEGDEVSVLKPA
FT                   GAFNCIDCMPTATKKVTLVSAGCGITPVMAMAKYWLAQGSDIEIDFVHMARNKRETIYF
FT                   QELHQLDDAHSNFNLKLLLKDSEGTLAPQGRLDKNWLVKLSPDILDRTVYLCGPVGFMQ
FT                   NIESYLKELEFNMENFYQESFTPANPNTDSLANSNTASEESQAEASADSNGAVKVFVPA
FT                   FGAEVEAEAGTPLADSLEKAGVPIIIACRSGICGSCKCKVTKGSVESSSQETLTPEQIE
FT                   QGYVLACSSTIQSDVEVEL"
     atgtatgcat ggtcggatag cgattcaatc aatttagtgt gtttaaagaa atggcacgag        60
     acgccagata cggtcagctt tgagcttggc agtattccac aagacttaca tttcaatttt       120
     aagcctgggc aattcattac tctgggttta gatatgccga cgaaaacaga ttatcgcgcc       180
     tattctgtgg cttcttgtcc tgaagataat cgcctgaagc tcacggtgaa acgtgtggaa       240
     ggtggcttgg tttcgaactt tattgttgat gagcttgatg aaggtgatga ggtttctgta       300
     ttgaagcctg ctggcgcgtt taactgtatt gattgtatgc caacagcgac gaaaaaagtg       360
     acgctagtga gtgcaggttg cggtattaca ccggtgatgg cgatggcaaa atattggttg       420
     gctcaaggca gtgatattga gatcgacttc gtccacatgg cacgcaataa gcgtgagacc       480
     atttactttc aagaactgca tcaattagat gatgcgcaca gcaacttcaa tcttaaattg       540
     ctgctaaaag acagtgaagg aacattagct cctcaaggtc gattagataa gaattggtta       600
     gtaaaactaa gcccagatat tttagaccga actgtttatc tgtgcggccc agttggcttt       660
     atgcaaaaca tagaaagcta cctgaaagaa ctagaattca acatggaaaa tttctatcaa       720
     gaaagtttca cgccagcgaa cccaaacacg gattcactag ccaatagcaa tacagcttca       780
     gaagagtcac aagcggaagc gtctgcagat tcaaatggtg ccgttaaggt gtttgttcct       840
     gcatttggcg cagaagtaga agcggaagcg ggtacaccac tggctgattc attagagaaa       900
     gctggagttc cgattattat tgcttgtcgc agtgggattt gtggttcttg caagtgcaaa       960
     gtaaccaaag gttcagtgga atcaagcagc caagaaacat tgacgccaga acagattgag      1020
     caaggttatg tccttgcgtg ttcgagtacg attcagtcag atgttgaggt tgagctgtag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page