(data stored in SCRATCH zone)

EMBL: FM954973.PE349

FM954973.PE349       Location/Qualifiers
FT   CDS_pept        398195..400780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0356"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25798"
FT                   /db_xref="GOA:B7VQX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015387"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25798.1"
FT                   /translation="MKKSYAITPKNTLAKLITRIIILVIGVMALGVLIHNYETSSRIVK
FT                   QETNRTVKQTSSLIQNMFDYRLSVLQIHQDSPQDSSSHSETLREYFDTNNEEALSYFFY
FT                   GVDQREPDHAPDLRFVSTYNGLAWEDGNGQFYGLDESSLKHISDEVAFSSNWHFIQLTT
FT                   DIGKRHLLARRTPIVDNKTGEVLGQLYVAIVLDNNFSLAESIQQGSNCENIVIEAHGTP
FT                   VTSTFSGDESYTIKDVLSYEMYEQLPRHFVTIATIKINAVETPLTIRAIQKNTNLIALE
FT                   DNYERTIIVMIVVIIIMSFLARSWIQRRVAAELDKLMEFTRSASGNEEFSKFDGSNIFE
FT                   FHHIGCTLEDTFERLSEQHQKFQDLFNFAHSPILVWSEKGDLIQMNPAARMALFDEDDN
FT                   YGAMAREFELRMLPNIQMVVQGSKLTGINVPIGEKVFRWNMSAIRVEHGITGVVVQGQD
FT                   ITKLIEAERQADRAREEAEHLASVRADFLAKMSHEIRTPLNGILGVSQLLKRSIHDEDN
FT                   RDQVDVLCHSAEHLLAVLNDILDFSKIEQGQFNIQKKDFLLGELVNTLDSIYRPLCEDK
FT                   SVEFTIVNHLIDDIKIHTDQVRLNQIMFNLLSNALKFTHQGSISVSFEIESILNTDFAS
FT                   LIVRVKDSGIGIDESKIDAIFEPFVQAEETTTREYGGSGLGLTIVKNLVDMLEGDIQVR
FT                   SVKDQGSEFIIEIPVELHSKPLFVDVKKQAHIEPEALFSRSLKVLLVEDNHTNAFIAQA
FT                   FCKKYGMVVTWAKGGLEAIELAKNTVYDLILMDNQLPNLGGIETTQQLREQIGVTAPIY
FT                   ACTADAQESTRERFMAAGANYVIVKPIKEASLHKAFVHFKQLYWDDTQH"
     atgaaaaaaa gctacgccat tacaccaaag aacactttag ccaaattaat tacgcgtatc        60
     attattttag tgattggcgt gatggcgctt ggcgtgctta ttcataacta cgaaacaagc       120
     agtaggatcg ttaagcaaga gacgaataga acggttaagc aaacttctag cttgatccaa       180
     aacatgttcg attatcgatt gtcagtgctg caaatccatc aagacagtcc tcaagacagt       240
     agctcacaca gtgaaacttt aagggagtat tttgatacca acaatgaaga ggctctgagc       300
     tacttttttt atggtgttga ccaacgtgag cctgatcatg ctcctgattt gcgttttgtt       360
     tcaacttata atggtttagc ttgggaagat ggcaatgggc agttctatgg tttggatgaa       420
     tctagtttaa agcatatatc tgatgaggtc gcttttagca gtaactggca cttcattcag       480
     ctgactacgg atatcggtaa gcgtcatttg ttggctcggc gaacccctat tgttgataac       540
     aaaaccggtg aagttctagg gcagctttat gtcgctattg tgctcgacaa caatttttca       600
     ttggctgaat ctatccagca aggcagcaat tgcgaaaata tcgttattga agcgcatggt       660
     actccggtga catcgacatt cagtggcgat gaaagctata cgataaaaga cgtcctcagc       720
     tatgaaatgt acgagcagct acctcgtcat ttcgtcacta ttgcaaccat taagatcaat       780
     gctgttgaaa cccccctaac cattcgcgcg atccagaaaa acactaacct cattgcactc       840
     gaagataatt atgaacgtac catcattgtt atgattgtgg tgatcatcat catgtctttc       900
     cttgcgcgat cttggattca aagaagagtc gcggcagaac ttgataagtt aatggaattc       960
     actcgttctg caagtggtaa tgaagagttc agcaagtttg atggttcaaa tattttcgaa      1020
     tttcaccaca ttggctgcac gttggaagat acttttgagc gcttatctga gcaacaccaa      1080
     aaatttcaag atctgtttaa ttttgcgcat tctccaattt tggtttggtc cgaaaaaggt      1140
     gacttaattc agatgaaccc agcggctcgt atggcgctat ttgatgaaga tgataactat      1200
     ggtgcaatgg ctcgagagtt tgagctccgt atgttgccga atatccagat ggtggttcaa      1260
     ggctctaaac taacgggcat taacgtgcca atcggcgaga aggtttttcg ctggaacatg      1320
     tctgcaatcc gagttgaaca cggcattacc ggtgtggtgg tgcaaggtca agatattact      1380
     aaacttatag aagcagaaag acaggcagat cgagcgcgtg aagaggcaga gcatcttgcc      1440
     agtgtgcgtg cagacttcct cgctaaaatg agtcacgaaa ttcgtacgcc attgaatggt      1500
     atcctcggtg tctctcagtt gcttaaacgt tcaatacacg atgaagataa ccgtgatcag      1560
     gttgatgtac tttgccatag tgcagaacat ctactggcgg tactaaacga tattttggac      1620
     ttctctaaga tagagcaggg acaatttaat attcagaaga aagatttcct cttaggagag      1680
     ttagttaaca ccttagatag catctatcgc ccactttgtg aggataaatc cgtcgagttt      1740
     accattgtga atcacttgat tgatgacatc aaaatacaca ccgaccaggt tcgcttgaac      1800
     cagatcatgt ttaatttact gagcaatgcc cttaagttca ctcatcaagg cagtatttcc      1860
     gtcagttttg aaatcgaaag tatcttgaat actgatttcg ctagcttgat tgttcgagta      1920
     aaagacagtg gcatcggtat tgatgagagt aagatcgatg ctatttttga accttttgtt      1980
     caagcagaag aaacgacgac tcgggagtat ggcggttcag gacttgggct tacgattgta      2040
     aagaaccttg tcgatatgct ggagggagac attcaagtcc gaagcgttaa agatcagggg      2100
     tctgagttca ttatagaaat cccagtggag ttacactcca agcctctgtt tgtcgacgtt      2160
     aagaaacaag cccacatcga gcctgaggca ttgtttagtc gttcgttgaa agtgctgcta      2220
     gtggaagata atcacactaa cgcctttatc gcacaggcat tttgcaaaaa gtatgggatg      2280
     gtggttactt gggcaaaagg tggcttggaa gcgatagagc tagcaaaaaa cacggtttac      2340
     gatcttatct taatggataa tcaactccct aatctgggtg gaattgaaac cactcagcaa      2400
     ctaagagagc aaattggcgt aacagctccg atttatgcgt gtactgccga tgctcaagag      2460
     tcaacaagag aaaggttcat ggctgctgga gcaaattacg tgatcgtaaa accgataaaa      2520
     gaagcgtcgt tgcacaaagc ttttgttcat ttcaaacaat tgtactggga tgatactcag      2580
     cattaa                                                                 2586
//

If you have problems or comments...

PBIL Back to PBIL home page