(data stored in SCRATCH zone)

EMBL: FM954973.PE351

FM954973.PE351       Location/Qualifiers
FT   CDS_pept        400885..401235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25801"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25801.1"
FT                   /translation="MELQTLLNTLADTPESVQFEDTIQVIEAHYDFAESEFRNGDVVNA
FT                   AGQNNGSCKIFAFGLEQGLSAEQTLACFGQFYRNDVLGFPDNTDHQNIRNFMTHGWSGV
FT                   QFSQPALIAKSK"
     atggaactgc aaaccttatt gaatactctg gctgataccc cagaaagcgt gcaatttgaa        60
     gacacaatac aagtgataga agctcattat gattttgctg agagtgaatt tcgtaatggc       120
     gatgtagtga atgccgctgg gcagaataat ggttcgtgta agatttttgc ttttggttta       180
     gagcaaggtc tatctgcaga gcaaacactt gcttgttttg gtcaatttta tcgtaatgac       240
     gtattaggtt ttccagacaa cactgaccat caaaatattc gtaacttcat gactcatggc       300
     tggagcggag tacagttttc tcagcctgcg ctgattgcaa aatcgaagta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page