(data stored in SCRATCH zone)

EMBL: FM954973.PE354

FM954973.PE354       Location/Qualifiers
FT   CDS_pept        403968..405026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0361"
FT                   /product="outer membrane protein N"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25806"
FT                   /db_xref="GOA:B7VQX7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25806.1"
FT                   /translation="MNKKLLALAISGAVFGTQAVAVELYNEDGTAFSVGGHVSVNLNGS
FT                   EKGDTDVGTNSPRINFNATQELGNGFTADAKGEWALNYLNGGDESFTTRLGYVGLTHDE
FT                   LGRAVAGTQWAPYYDVASATDMPIAFANDFLYDNHGALGTGRADKMASYRNGFDFGEAG
FT                   ELSFGLGWQGSNTVTTDVYDDTDINDIIHSRTTVAYDDRIQATLGYSIAGVKLGYAFNT
FT                   GDFKEGGVSKTAESHLVSAAYGSYGSGLYLAGIYASNENMNAGLEESDAYELLAAYALA
FT                   NSLNLSVNYEVVEGEATKGAATQTDREELALQAEYNFTSNVVGYTGYQFDLNDADNRKT
FT                   DDKWTIGARFYL"
     atgaataaga aacttttagc gctagcaatt tctggtgcag tatttggtac acaggcagtt        60
     gcggtagagc tttataacga agacggtaca gccttctctg ttggtggtca cgtttctgta       120
     aacctgaatg gttcagagaa aggcgatacg gatgttggta caaactcacc acgtatcaac       180
     tttaatgcta cgcaagaatt aggtaatggc ttcacagctg acgctaaagg cgaatgggcg       240
     cttaattacc taaacggtgg tgatgagtcg tttactactc gtcttggtta cgtaggttta       300
     actcatgatg agctaggtcg tgctgttgca ggtacgcagt gggcgccata ctacgatgta       360
     gcttcagcta ctgatatgcc gatcgctttc gcgaacgatt tcttatacga caaccacggt       420
     gcgctaggta ctggtcgtgc agacaaaatg gcaagttacc gcaacggatt tgattttggt       480
     gaagcgggtg agcttagctt tggtctaggt tggcagggta gtaacacagt aacgacagac       540
     gtttacgatg acacagatat caacgatatc attcactctc gtacaacagt tgcgtacgat       600
     gatcgtattc aagcgactct tggttactca atcgctggtg ttaaattggg ttatgccttc       660
     aacactggtg acttcaaaga gggtggtgtt tctaagacgg ctgaatctca cctagtttct       720
     gctgcatacg gttcttacgg ttcaggttta tacctagcag gtatctacgc ttcaaacgaa       780
     aacatgaacg caggccttga agaaagtgat gcatatgaat tgctagcggc ttacgcttta       840
     gcgaacagct taaacttaag cgttaactac gaagttgttg aaggcgaagc gacgaaaggc       900
     gcggcaacac aaactgaccg tgaagagcta gctctacaag ctgaatacaa ctttacgagt       960
     aatgttgttg gctacactgg ctatcagttt gatctaaacg atgctgacaa cagaaaaact      1020
     gacgacaagt ggactattgg tgctcgtttc tacctataa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page