(data stored in SCRATCH zone)

EMBL: FM954973.PE361

FM954973.PE361       Location/Qualifiers
FT   CDS_pept        412851..413735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0368"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25819"
FT                   /db_xref="GOA:B7VQY4"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25819.1"
FT                   /translation="MSSKKEVYFVPHQSHWPLVGAVALFLVAVGAGLTVQNMGTDAAGG
FT                   VFGKAVLLVGFCVLLYMLAGWFSNVITESLSGVYSEQISRSFRQGMSWFIFSEIMFFGA
FT                   FFGALFYARMISVPWIGGAGNNAMTHEVLWPMFQSMWPLTTTPDGVTTEAMSWQGIPLK
FT                   NTIILLLSSVTLHMAHLSLEQNKRMALIVWLEVTIVLAGFFLFFQVEEYLHAYQEMGLT
FT                   LQSGIYGNTFFLLTGFHGLHVCLGTIFLIVLLVRVAKDHFTPKDHFAFQAGSWYWHFVD
FT                   VVWLGLFVFVYVL"
     atgagttcta aaaaggaagt ttatttcgtt ccacatcaaa gccactggcc attggtgggt        60
     gccgtagcgc tgtttttggt cgcggttggc gctggcttga cggtgcaaaa tatgggcacc       120
     gacgctgctg gcggtgtgtt tggaaaagca gttcttttag tcggattttg tgtgttgctt       180
     tacatgctcg caggatggtt tagcaatgtg atcacggaat cattaagtgg cgtttattct       240
     gagcaaatat cccgctcctt taggcaaggc atgagttggt tcatcttctc tgaaattatg       300
     ttcttcggcg ctttctttgg cgcgcttttc tacgctcgta tgatttctgt gccttggatt       360
     ggcggggcag gcaacaatgc aatgacccat gaagtgttgt ggccaatgtt tcaatcaatg       420
     tggccgctaa ccactacccc tgatggtgtg acgacagaag cgatgtcttg gcaaggtatc       480
     ccgcttaaga acaccattat cctgctgctt tcatcggtaa cacttcatat ggcgcaccta       540
     agccttgaac agaacaagcg tatggctttg atcgtgtggc tggaggtaac cattgttctg       600
     gctggcttct tcctattctt ccaagtcgaa gagtaccttc acgcttatca agagatgggg       660
     ttgacacttc aatctggcat ctacggtaat accttctttt tgctgactgg gtttcatggc       720
     ttgcatgtct gtctagggac gatctttttg attgtgttgt tggtgagggt agcgaaagac       780
     cacttcactc cgaaagacca ctttgcgttc caagcgggca gttggtattg gcactttgtt       840
     gatgtggttt ggttaggcct gtttgtgttt gtttatgtgc tttaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page