(data stored in SCRATCH zone)

EMBL: FM954973.PE369

FM954973.PE369       Location/Qualifiers
FT   CDS_pept        complement(419340..419477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25833"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25833.1"
FT                   /translation="MQAHIAADVTLVIIFNHPSFQLLINNLKVDARFIRAHSELKTTLI"
     gtgcaagcac acattgccgc cgatgtaacg ctcgttatca ttttcaacca tccatcattt        60
     caattattaa tcaacaactt aaaagtagat gctcgtttta ttcgtgctca ttcagagtta       120
     aaaactactc ttatttag                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page