(data stored in SCRATCH zone)

EMBL: FM954973.PE372

FM954973.PE372       Location/Qualifiers
FT   CDS_pept        421035..421463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0380"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25838"
FT                   /db_xref="GOA:B7VQZ5"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25838.1"
FT                   /translation="MRFSYRSQKANEEALWQLEVAKLYIDYAKYCSTLFSSLLAGQVTL
FT                   LGAVFSELESREFAVYAIVLMVFAVASAYSIAETELRRLRVREIDRDFPRYAVLKKYFP
FT                   NHTLVQTGKSFLTGILVVSSICCYLYFLHLGNVIKLSL"
     atgagattta gttatcgctc ccaaaaagcc aatgaagaag cattgtggca gcttgaggtc        60
     gccaaattgt atattgacta tgccaaatat tgctctactt tgttttcgag cctattggca       120
     gggcaagtta ctcttcttgg tgcagtattt tcagaactcg agtctagaga gttcgctgtc       180
     tatgctatcg tactgatggt tttcgcagtt gctagtgctt actctattgc tgagactgag       240
     ttgaggaggt taagagtgcg tgaaattgac cgtgactttc caagatatgc agtacttaaa       300
     aaatattttc cgaatcacac tttagttcaa actggtaagt catttttgac aggaattttg       360
     gtcgtgtcgt ctatttgttg ttatttgtat ttccttcatc taggtaacgt gatcaagcta       420
     tcactttaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page