(data stored in SCRATCH zone)

EMBL: FM954973.PE397

FM954973.PE397       Location/Qualifiers
FT   CDS_pept        448354..449370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0405"
FT                   /product="TRAP dicarboxylate family transporter, DctP
FT                   subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25881"
FT                   /db_xref="GOA:B7VR20"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25881.1"
FT                   /translation="MKALTKTLIAASLTGLFATSAMAADFKLKIQSSDPSGDLNFKVQQ
FT                   KWAERVETMSNGRIDIDLLPVGAVVKHTETLGAIKMGILDGHITATGYFSGKDPAFGLI
FT                   GNMVGAWSDTTQLLQYMNYGGGNELMTELYKPYGVQFVGASTTGVESFISKKPIDGVAD
FT                   LKGLKLRAPEGLVQQVFAAAGATPVNLPGSEVFTGLSKGVIDAADYTVFSTNQKAGMND
FT                   IATHPVQPGFHSLPLIDISISQKKWDKMPADLQTMLQTSVRDFSYDMTTQLKMADQAAL
FT                   KEAQANPEITIHDWSQEERKKFREIAKGQWKVFAERSDNAGKVYTSVTVFLEENGLL"
     atgaaagctc tgactaaaac gctgattgct gcttccctca ctggtctatt tgctacttca        60
     gcaatggctg cagactttaa acttaagatt caatcttcag atccatctgg cgatttgaac       120
     ttcaaggttc agcaaaagtg ggctgagcga gtagagacga tgtctaacgg acgtattgat       180
     atcgatctac ttcctgttgg cgctgtggtt aagcacacag aaacgcttgg tgcgatcaaa       240
     atgggcatcc tagatggtca catcacagca acaggttact tctctggtaa agatccagca       300
     tttggtctta tcggtaacat ggttggcgca tggtcagata caacacaact gcttcagtac       360
     atgaactacg gtggtggtaa tgagctaatg accgaactgt acaagcctta cggtgttcaa       420
     tttgttggtg cttctacgac gggtgttgaa tctttcattt ctaaaaagcc aatcgatggt       480
     gttgcggatc ttaaaggcct gaaattacgt gcgcctgaag gcctagttca acaagtattt       540
     gcagccgcgg gtgcaactcc agtaaacctg ccgggttctg aagtatttac tggcctaagc       600
     aaaggcgtaa ttgatgccgc ggactacacg gtattctcta ccaaccaaaa agcgggcatg       660
     aacgatatcg ctactcaccc agttcaaccg ggtttccact cattgccgct tatcgatatc       720
     tctatttctc agaagaaatg ggacaagatg ccagctgatc tacaaacaat gctgcaaaca       780
     tcagtgcgtg acttctctta cgacatgacg actcagctga aaatggctga ccaagctgcg       840
     cttaaagaag ctcaagcgaa ccctgaaatt actatccacg actggtctca agaagagcgt       900
     aagaagttcc gtgaaatcgc gaaaggccaa tggaaagtat ttgcagagcg ttctgataac       960
     gcaggaaaag tttacacttc agtaacagtg ttcctagaag aaaacggctt actgtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page