(data stored in SCRATCH zone)

EMBL: FM954973.PE399

FM954973.PE399       Location/Qualifiers
FT   CDS_pept        449986..451308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0407"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25885"
FT                   /db_xref="GOA:B7VR22"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25885.1"
FT                   /translation="MFDLSSIGIAWGSLLMLVMMIGLLLTGMQLAFVTGFVAIFFTLCW
FT                   FGPDALPLIASRTYSFASGYVFLAVPMFVLMAALLDRSGIARDLFDAMKSVGRKVRGGV
FT                   AVQTLLVAVLLASMSGVIGGETVLLGILALPQMLRLGYDRKLAIGTTCAGGALGTMLPP
FT                   SIVLIIYGMTASVSIGDLFKASFLPAFILAGCYIGYVLIRCKLNPSLAPIPSDDETEED
FT                   IANQPSYFKALFFPLLSVATVLGSIYTGIASVTEASALGVVGIMISALIRGELNYNMLK
FT                   ESAIATMRTCGMIMWIGIGASALVGIYNLMGGIDFVEETILALSGGNATVTLLIMMAIL
FT                   LVLGMFLDWVGVALLTMPIFVPIITGLGFDPVWFGVVFCLNMQVSFLSPPFGPAAFYLK
FT                   SVAPKDISLGEIFSSLLPFIALQVLVLALVIIFPQLALWWQ"
     atgtttgatt tatcttctat tggtatcgca tggggcagtt tgctcatgct ggttatgatg        60
     attggtttgc tactgaccgg tatgcagcta gcgttcgtaa caggctttgt cgcgattttc       120
     ttcactctgt gttggtttgg tcctgatgcc ttacctttga tcgcaagccg tacctacagc       180
     tttgcttctg gttatgtttt ccttgccgtt cccatgttcg tattgatggc cgctttacta       240
     gaccgttcgg gtatcgcgcg tgatctgttt gatgcaatga aatctgtcgg ccgtaaggtt       300
     cgtggcggtg ttgcggtaca aaccttattg gtagctgtgt tactggcttc gatgtcaggt       360
     gttatcggtg gtgaaacggt actactgggt attcttgctc tgcctcaaat gcttcgttta       420
     ggttacgacc gtaagcttgc tatcggtaca acctgtgcgg gtggcgcact tggtaccatg       480
     cttccgccaa gtatcgtact gatcatctac ggtatgacag ccagcgtatc gatcggcgac       540
     ttgttcaaag cttctttcct acctgcgttt attcttgcgg gctgttacat cggctacgta       600
     ttgattcgct gtaagctcaa cccttctctt gcgccaattc caagtgatga cgagacagaa       660
     gaagacatcg ccaatcagcc aagctacttc aaagctctgt tcttcccatt gctttctgtc       720
     gcaacggttt tgggcagtat ctacacaggt atcgcatcag taacagaagc gtctgctttg       780
     ggtgtagttg gcatcatgat cagtgcacta atccgtggtg agctgaacta caacatgctg       840
     aaagagagtg ccatcgcaac catgcgtact tgcggcatga tcatgtggat tggtatcggt       900
     gcaagcgcat tggttggtat ctacaacctg atgggcggta ttgattttgt tgaagaaacc       960
     atccttgcgc tcagtggcgg taacgcgaca gtaacgctat taatcatgat ggctatcttg      1020
     ttggtactag gcatgttcct tgactgggta ggtgtagcac ttctaacaat gccaatcttc      1080
     gttccaatca tcactggcct tggttttgac ccagtatggt tcggcgttgt gttctgtcta      1140
     aacatgcagg tgtcgttctt gtcaccacca tttggtcctg cggcattcta cttgaaatca      1200
     gtagcaccaa aagacatcag cttaggtgag attttctctt cattactgcc gttcattgca      1260
     cttcaagtat tggttctggc actggttatt atcttccctc agctcgcgct ttggtggcaa      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page