(data stored in SCRATCH zone)

EMBL: FM954973.PE410

FM954973.PE410       Location/Qualifiers
FT   CDS_pept        463412..465523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0418"
FT                   /product="hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25903"
FT                   /db_xref="InterPro:IPR031025"
FT                   /db_xref="InterPro:IPR032295"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25903.1"
FT                   /translation="MKYKQVIYLMTAVASAPVYATTVDLDFSNHVEATNGSSSWAGPTY
FT                   DGSSMHFLNVGTHDGKTIDAKVSSSVFGDATFLFHAPNYKVGATQPSGDIGFLYQTNSA
FT                   GSAGLTYTFEFYDGTDGLSGTFSVPYTLPEFDMIGYDIDGEPVQSEQVRVFKSEGFYSY
FT                   QLGSASASLMAEESADGTSVLFTGPGTNYSETDTSGAVKFTYKNTSIVTLQFETVTSSS
FT                   SSFPNPIFSAFDGNWDLSGFTTPIESSDESDFGDAPDSYGTLQASNGAEHAISSTLYLG
FT                   ASVDADTDGQPGASSNGDDLDVGGNDDDGIALLTNLEVGLDSLINVNVVGSGYLQAWAD
FT                   WDMNGSFEDDEQILKNHSVVDGSQVVPIRVGDDAVVGSVQTRFRLASSPNIPSDGYVGD
FT                   GEVEDYVFNVTDPGTTVQHSNYYTAAFEDNWPEVGDFDLNDVVVYYRTTILSKEDAVLR
FT                   MDITGTIMAYGASYGNGLGWKLSGFDESDVDLQTARVQKNGATRVNISPFTGEDKSVAS
FT                   PGGDLVVVASLNLKNDLPINGECMFHRTNPSCSPTLEADQMTFSISLPFASGSEPTASS
FT                   LMPLSGFDPFIFGAGAGYYHGDSFSTSPGKDLEIHTADFPPTSRGTLVSDFYGIAQDDS
FT                   DPSSDKYYRTTQNMPWGILISSSWNHPSEYIDVSEVYPEFAEWATSGGASKPTWYQNPN
FT                   ANKTWSTED"
     atgaaataca agcaagttat ttatcttatg acggccgttg ccagtgcccc tgtctatgca        60
     acgacggtag atttggactt ttcaaatcat gtagaggcga cgaacggcag cagttcctgg       120
     gctgggccaa cctatgatgg atcttcgatg cacttcctca acgttggtac acatgatgga       180
     aaaacaatag atgccaaagt gtctagtagt gtgttcggtg atgcgacatt tttgtttcat       240
     gctcctaact acaaagttgg tgcaacacaa ccctcaggag atattggttt tctctatcaa       300
     actaactctg cgggctctgc aggtctaacc tatacctttg aattttatga tggtacggat       360
     ggactctcag gtacgttctc agtgccttat acacttcccg aatttgacat gattggctat       420
     gacattgatg gcgaacccgt gcagtcggag caagtaagag tgtttaaaag tgaaggtttc       480
     tacagttatc aacttggtag tgctagcgcg agtttgatgg cggaagagag tgccgatgga       540
     acgtcggttc tattcaccgg gccaggtacg aactattcgg aaaccgacac ttccggtgct       600
     gtaaaattca cctacaagaa tacctcgatt gtaactctac aatttgaaac ggttacgagc       660
     agtagcagta gtttccccaa cccgattttc tcggcatttg acggtaactg ggacttatct       720
     ggatttacta cgccaataga aagttcagat gaatctgatt ttggtgacgc tcctgatagt       780
     tatggaacgt tgcaggcgag taacggtgct gagcatgcga tatcttccac actgtactta       840
     ggtgctagtg ttgatgccga tacagatggc caacctggtg catcatccaa cggcgatgat       900
     ttggatgttg gcggaaatga tgatgacgga attgcactgt tgacgaatct tgaagtcggc       960
     ttagacagtt taattaatgt caacgttgtg gggagtggtt atctgcaagc ttgggctgac      1020
     tgggatatga atggatcttt tgaggatgac gagcagatat taaaaaatca ttctgttgta      1080
     gatggaagcc aagtcgtccc aattcgagtg ggtgatgatg ctgtcgttgg gagcgtacaa      1140
     actcgattcc gtttagcgag tagccctaac attccgagtg acggttatgt tggtgatggt      1200
     gaagttgagg actacgtgtt taacgttacg gatcctggca caacggttca acattcgaat      1260
     tactatacag cggccttcga agataattgg ccagaagttg gtgacttcga cttaaatgac      1320
     gttgtggttt actaccgtac caccatttta agtaaagagg acgcagtgct tcgaatggat      1380
     attacgggaa ccataatggc ctacggtgct tcttatggta atggactggg atggaagctt      1440
     agtggcttcg atgagtcaga tgtcgatctt caaacggctc gagtgcaaaa gaatggcgcg      1500
     actcgggtaa atatttcgcc gtttacgggg gaagacaaaa gtgttgcatc gccaggggga      1560
     gacctcgttg ttgtcgcgtc gttgaaccta aaaaatgatc tgccgattaa cggtgagtgt      1620
     atgttccacc gcactaaccc ttcttgtagt ccgactttag aagctgacca aatgacgttc      1680
     agtatttctc tgccgtttgc ttctggaagc gagcccacag cgagttcact gatgccatta      1740
     agtggcttcg acccattcat ctttggtgcg ggagcgggtt attaccatgg tgacagtttc      1800
     tctacatcgc cggggaaaga cttagaaatc catactgcgg acttcccacc aacgtcgcgt      1860
     ggcacgttag tgagtgattt ctatggtatt gcacaagatg attcagaccc gtctagtgat      1920
     aaatactacc gaacgacaca aaacatgcct tggggtatct taatttcatc atcttggaat      1980
     catccatcag aatacattga tgttagtgag gtgtaccccg agtttgctga gtgggctaca      2040
     tcaggcggtg cttcaaaacc aacgtggtac caaaacccta acgccaacaa aacttggtca      2100
     acggaagatt aa                                                          2112
//

If you have problems or comments...

PBIL Back to PBIL home page