(data stored in SCRATCH zone)

EMBL: FM954973.PE414

FM954973.PE414       Location/Qualifiers
FT   CDS_pept        468053..469837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0422"
FT                   /product="Hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25910"
FT                   /db_xref="GOA:B7VR37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25910.1"
FT                   /translation="MLKGVDLKYLKHFFKFAKKYKRSAILGIAMLPLSVITSLLFPWLI
FT                   IQVIDVHLSHGDMDGLLEYVFYLVAVLVASYVVDTTYSYNLRKTGQYTITDMRSVLFAR
FT                   VLKLPRSYFDNTPIGVTLSRLTSDLETIGETFVQSVVGLVKDSINTIALLVMMFFIDWQ
FT                   LTMIVLIIMPPVMYLTVYVRNRLRELYKVTRSSLARGIGFLQEVLFGMKTVQMYRAEEQ
FT                   VEQRYQGYTDEFLRAQKKINKYDAILFSFISGITSITIAIMIWYGSEQVIEGALTLGVL
FT                   IAFINTLEKVFVPIRDFTSQIASIQSSFAAFDHIEELFVEPTEEEGRNLLLSSKVEKQL
FT                   EQFVSLEFKSVSFRYKDDSPYVLKNVSFVLEKGHQIALVGSTGSGKSTVLRLISKTYQD
FT                   YEGSILLNGIELSQVSSEDSAHLFSMMMQDVHLFEETIQFNIALGKTHLSRTEVEQAAR
FT                   YVYADKFIEQLPQSYDFHLEKNGSNLSVGQTQLISFARAVAQGGQLMMLDEATSSVDSI
FT                   TEDLIQKAMQRLFKEKTVIAIAHRLSTVRHSDTILVLEKGEIVEQGNHRQLIAHNGIYA
FT                   ELLEESVVGGIDCRKSRL"
     atgttaaaag gtgttgatct caagtacctc aagcactttt ttaagtttgc taagaaatac        60
     aaacgctctg cgattctggg cattgctatg cttccgctct ctgtcattac aagcctattg       120
     tttccttggc tgatcattca agtgatcgat gttcatctga gtcacgggga tatggatgga       180
     ctgctcgaat acgtcttcta tctcgttgcc gtgctggtgg cgagctatgt ggtggatacc       240
     acctattcgt acaacctgcg taaaactggt caatacacga taactgacat gcgctcagta       300
     ttgtttgctc gcgtgctcaa actgccgcgc agctattttg ataacacacc gattggggta       360
     acgctctcac gattaaccag tgacttggaa accattggcg agacgtttgt tcagtcggtt       420
     gtggggctag ttaaagacag tatcaatacc attgctctgt tggtgatgat gttcttcatt       480
     gattggcagt taacgatgat tgtattgatc attatgccgc cggtgatgta tttgacggtg       540
     tatgtgagaa accgacttcg tgaactgtac aaggtgactc gttcttcgct cgctcgcggt       600
     attggctttt tacaagaagt cttatttggt atgaaaaccg ttcagatgta ccgagcggaa       660
     gagcaagtag aacagcgtta ccaaggctat accgatgagt ttttaagagc gcagaaaaag       720
     ataaataaat acgatgcgat tttgttctcg tttatctctg gcatcacctc tatcaccatc       780
     gcaattatga tctggtatgg atctgagcaa gtgatagaag gggcactcac cttgggtgtg       840
     ctaattgcgt tcatcaacac cttagaaaaa gtgtttgtgc cgatccgtga ctttacttcg       900
     cagattgctt cgattcagag ttcatttgca gcgtttgacc atattgaaga gctgtttgtt       960
     gagccgactg aagaagaagg gcgcaacctg ttgctatcga gcaaggttga aaaacagctc      1020
     gaacagtttg tgagcctaga gtttaagagc gtgagcttcc gttacaaaga cgactctccc      1080
     tatgttctaa agaatgtctc gtttgtattg gagaaagggc atcaaatcgc gcttgtaggt      1140
     tcgacggggt cgggtaagtc gacggttctg cgtctgatct ctaaaaccta ccaagactat      1200
     gaaggcagca ttttgttgaa tggaatagag ctgtcacagg tttcaagtga agactctgct      1260
     catttgttct caatgatgat gcaagatgtg cacttgtttg aagagacaat ccaattcaat      1320
     atcgcgctgg gtaaaacgca tctatctaga actgaggttg aacaagcagc acgctatgtg      1380
     tacgccgata agtttattga acaattgcca caaagctatg acttccattt agaaaagaac      1440
     ggatccaacc tatctgtggg gcaaacgcag cttatttcgt tcgctagagc ggttgcacaa      1500
     ggtggacaac tgatgatgct tgatgaagca actagctcgg tggattcaat caccgaagac      1560
     ctgattcaaa aagcaatgca gcgtctgttt aaggaaaaaa ccgtgattgc gattgcacac      1620
     cgtttgagta ccgttcgtca ctcagacacg attcttgtgt tggaaaaggg tgaaattgtt      1680
     gaacaaggta accatcgaca gctgatagca cacaatggaa tttatgcaga attgttggaa      1740
     gagtcggtgg ttggaggaat cgattgtaga aagagtcgat tgtag                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page