(data stored in SCRATCH zone)

EMBL: FM954973.PE43

FM954973.PE43        Location/Qualifiers
FT   CDS_pept        complement(54927..57122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0045"
FT                   /product="Conserved hypothetical protein with GGDEF and EAL
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25255"
FT                   /db_xref="GOA:B7VQ16"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25255.1"
FT                   /translation="MKRSLSWTIIYPIIGIALACILLFSLISTVILEDFVQKVSVENAK
FT                   NYVTTFHSIRNYYSSNVVQKVVDSQELVATAQHQSLENSIPVPATFLIEMLDKSDKDLT
FT                   ITTSFTSPYPFKNRQGRLFDEFQQRAWVAINKKPDEFYVEFVQEQDRTRVRVARADRLY
FT                   DQTCVNCHNSHPDSPKHDWELNDVRGILEVNTVVDEWLKYGKMINQSLMSISIISFMTV
FT                   MFINFAIARRVSTPLKNITRSLSLLAQGKEESASLPPAKYYEITELQSAFSSLYDKEQQ
FT                   RRALTKEIETLAYYDSLTKLPNRLGFLRSLDELLNKHKEKNERITVLIIDIKRFRDINN
FT                   TLGYKAGDTILLHLANRLSACTTMVDFNLARLDENKFCIAVPAKEHNGDQGSDAFFAML
FT                   IDVVSNEIIIDENKIKLVANLGATCSSNGAQSSSEMLIQANIALYVSKEKGDDITVKHQ
FT                   PELSNAALRRITLIKEINNAIENREFIPYYQPQFCLKTNRIIGAEALMRWKKPNGDLVR
FT                   PDLFIELAEQSHLIIPMGAHIFEQATTDCQQWQNHKALAGVKVAVNISSIQFSEQNILD
FT                   LTQLTLEKTGLSPSLLELEITESAMLGDVSKVVAVLNDLKKLNIEIALDDFGTGYSSLS
FT                   YLKLLPIDRLKIDREFVKDLLSNTDDQAILSMICKLATELSLNVLAEGIEEKEQLEFLG
FT                   RAGCHEVQGFYFAKPMPLDDFVLFAKNHNSELINTHA"
     atgaagcgtt cactatcttg gaccattatt tatccaatca taggaatagc acttgcttgt        60
     attttactat tctctttaat atcgaccgtt atccttgaag atttcgttca aaaagtgtcg       120
     gttgaaaatg caaagaacta cgtgactaca tttcatagta ttcgtaacta ttactcatca       180
     aatgtcgtac agaaagttgt tgatagtcaa gaactcgtgg cgacagccca gcaccaatcc       240
     ttagagaaca gtattccggt tcctgctacc ttcttaatcg aaatgcttga taaatctgat       300
     aaagatctca ccatcacgac ctcgtttacc agcccttacc cttttaaaaa ccgtcaaggt       360
     aggctttttg acgaatttca acaacgggcg tgggtagcga ttaacaagaa accagatgag       420
     ttctacgtcg agtttgtaca agagcaagac agaacccgag tacgcgtcgc tcgggcagac       480
     cgcctctatg accaaacttg tgtaaactgc cacaatagcc accccgactc tcctaaacac       540
     gattgggaac tcaacgatgt acgagggatt ctcgaggtaa atacagttgt agatgaatgg       600
     ttaaaatatg gaaagatgat caatcaatct ttgatgtcta ttagcataat cagctttatg       660
     acggtgatgt ttattaactt tgccatcgct cgtcgagtat cgactccgtt aaaaaacatc       720
     actcgctctc ttagtttatt ggcacaaggc aaagaagaaa gtgcgtcttt accaccagca       780
     aaatattacg agataacgga actacaaagt gctttttcta gcctttatga taaagaacag       840
     caacgcagag cattaacaaa agaaatcgaa acactggcgt actatgattc gctcactaag       900
     ttgccgaacc gtcttgggtt tttgcgatcg cttgatgagt tgctcaataa acacaaagaa       960
     aaaaatgaac gcatcaccgt gttaatcatt gatattaaac gttttagaga tatcaacaat      1020
     acactcggct ataaagctgg ggacacaatc ttacttcatc tagccaaccg cttatccgca      1080
     tgcacaacca tggttgattt taacctagct cgattggatg aaaataagtt ctgtatcgca      1140
     gtgcctgcga aagaacacaa tggcgatcaa ggttcggatg ctttttttgc tatgttgatt      1200
     gatgtggttt caaatgaaat tatcattgat gagaacaaga taaaactagt ggctaacctt      1260
     ggtgcaacct gcagttcaaa tggcgcacaa agcagttctg aaatgctcat tcaagcgaac      1320
     atcgctctat atgtatccaa ggaaaaaggc gatgacatta cggttaagca tcaacctgaa      1380
     ctgtcgaatg ctgcgttgag acgtataacg ttaatcaaag agataaacaa tgcgattgaa      1440
     aacagagaat ttattcctta ttaccaacct caattttgct taaagaccaa tcgtatcatt      1500
     ggtgccgaag cgctcatgcg ttggaaaaaa ccaaatggag acctcgtaag gcctgacctt      1560
     tttatagaac tggcagagca atcccattta atcattccaa tgggggctca tattttcgaa      1620
     caagctacca ctgattgcca acagtggcag aatcataaag cgcttgctgg tgtaaaggtt      1680
     gccgttaata tttcgagcat tcagttttcg gaacagaaca ttttagatct gacacaacta      1740
     accttagaaa agactggcct ttctccgagt ttattggaat tagaaataac agaaagtgcc      1800
     atgttgggtg atgtgtcgaa ggtcgtggcc gtattgaatg acttaaagaa gttaaacatt      1860
     gaaatagcgt tagatgattt cggtactggt tattcatctc ttagctattt gaagctactc      1920
     cctatagatc gactgaaaat agatcgagag tttgtaaagg acttacttag caacaccgat      1980
     gaccaagcta tcttgagcat gatttgtaag ctagcaaccg aactctcact caatgtactt      2040
     gctgaaggca ttgaagaaaa agagcaactt gaatttttag gccgcgcagg gtgtcacgaa      2100
     gtacaaggct tctatttcgc aaaaccaatg ccactagacg attttgttct gtttgccaaa      2160
     aatcataact cggaactcat aaatacgcat gcttag                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page