(data stored in SCRATCH zone)

EMBL: FM954973.PE430

FM954973.PE430       Location/Qualifiers
FT   CDS_pept        complement(487458..488681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0438"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25935"
FT                   /db_xref="GOA:B7VR53"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25935.1"
FT                   /translation="MITNDAVIMGMLAVILGGVFITESSQNSALKKFYSFVPGLLLCYF
FT                   VPSLLNSLGIIDASNSKLYFVASRYLLPSALVLLIISADLRKIFGLGSKAVIMFLTGTV
FT                   GIIIGGPLAILIIDQVNPDLVSGDVWRGLTTVAGSWIGGGANQAAMKEVFEVDDQLFSA
FT                   MITVDVICANIWMAVLLIMAGRQKKIDAWLKADTSSIEELKETVSKYQEENARPTTTTD
FT                   LMKITAIAFGLTGLAHLFSDMIAPWISTNAPELAKYSLTSGFFWLIVMVTTFALIASCF
FT                   KSTRSLEHSGASKVGSAFIYILVATIGMQMDVTAILDNPGYFFIGITWLTIHALLMIVM
FT                   AKLIRAPLFFMAVGSQANVGGAASAPIVAAAFHPALAPVGILMAVLGYALGTYGAYICG
FT                   LIMQAAAG"
     atgattacta atgatgcagt aataatgggc atgttagctg ttattcttgg cggtgttttt        60
     atcacggaaa gtagccaaaa tagcgcactg aaaaaattct actcgttcgt tccgggtcta       120
     ttgctctgtt actttgttcc ttctctattg aacagcctag gcatcatcga cgcatcaaat       180
     tcaaagctgt actttgttgc aagtcgttac ctattaccaa gcgcactcgt tctactgatc       240
     atctcagctg acttacgcaa aatcttcggc cttggctcaa aagccgtcat catgttccta       300
     acgggtactg tcggcatcat cattggtggc cctttggcga ttctgattat cgaccaagtt       360
     aaccctgacc tcgtatctgg cgatgtatgg cgtggcctta caactgtggc tggttcttgg       420
     ataggcggcg gtgcgaacca agcagcaatg aaagaagtgt tcgaggttga tgatcaactc       480
     ttctctgcaa tgattacggt tgatgttatc tgtgcgaaca tttggatggc cgtgttactt       540
     atcatggcgg gtcgccagaa gaagattgat gcatggttaa aagcagacac atcatctatc       600
     gaagagctaa aagagacggt atctaagtac caagaagaga acgcacgccc aacaaccaca       660
     accgatctca tgaagatcac ggcaattgcc ttcggtttga ctggtttagc tcacttattc       720
     agtgacatga ttgcaccatg gatctcaacc aacgcgccag agcttgcgaa atacagccta       780
     acatcaggct tcttctggct gatcgtaatg gtgacaacat tcgcgctgat tgcttcatgc       840
     ttcaaatcta cacgcagcct tgagcacagc ggcgcgtcta aagttggttc agcgttcatc       900
     tacatcctag ttgcaactat cggtatgcaa atggatgtga cagctatctt agacaaccca       960
     ggttacttct tcattggtat tacatggtta actatccatg cccttctgat gattgtgatg      1020
     gcgaagctta tccgtgcacc actgttcttc atggctgtcg gtagccaagc taacgttggc      1080
     ggcgcagcat cggctcctat cgtagcagct gcattccacc cagcactggc gccagtaggt      1140
     attctaatgg cggtacttgg ttacgcacta ggtacatacg gcgcttacat ctgtggtctc      1200
     atcatgcagg ctgctgcggg ttaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page