(data stored in SCRATCH zone)

EMBL: FM954973.PE435

FM954973.PE435       Location/Qualifiers
FT   CDS_pept        493609..494043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25944"
FT                   /db_xref="GOA:B7VR58"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25944.1"
FT                   /translation="MRTVGNIIWFLFGGVFMGLAWWFFGLLAFLTIVGIPWGRACFVMG
FT                   NFSFFPFGQEAISRDELTNETDIGTSPLGLIGNIIWFLFAGIWLAIGHIMSAVACFITI
FT                   IGIPFAIQHLKLAVISLAPIGKTVVDKREAEAARVRNYKG"
     atgagaacag taggaaacat catttggttt ctgtttggtg gcgtatttat gggactggca        60
     tggtggttct tcggactgct cgcattcctc accatcgttg gtattccatg gggtagagcg       120
     tgttttgtaa tgggtaactt ctcattcttc ccatttggtc aagaagcgat ttcacgtgat       180
     gaattgacca atgaaacaga catcggtact agcccgcttg gtctgattgg taacatcatt       240
     tggttcttat ttgctggaat ctggttggcg attggtcaca tcatgtcagc agtagcgtgt       300
     ttcattacta tcatcggtat tccatttgcg attcagcacc ttaagcttgc ggttatctca       360
     ttggcgccaa tcggtaaaac ggtcgtcgac aagcgtgaag cagaagcggc acgagtaaga       420
     aactacaagg gttaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page