(data stored in SCRATCH zone)

EMBL: FM954973.PE450

FM954973.PE450       Location/Qualifiers
FT   CDS_pept        complement(509859..510179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0458"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25970"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25970.1"
FT                   /translation="MSISGIQSGYAIIQQSTNMAEEAAIELNQNSKHSPKTNDTFQTSD
FT                   LSFNQIEPEQPISFKEKEPEPASSSTEALLKLTQSANYNRVGASVVDRQNEAIGSLLDI
FT                   HI"
     atgtcgatat ctggtattca atctggttac gccatcattc agcagtcaac caacatggct        60
     gaagaagccg ctatcgagct taaccaaaac tccaaacact ctccaaaaac caacgacact       120
     ttccaaacta gcgatttgag cttcaatcaa atagaacctg aacaacccat ttcgtttaaa       180
     gagaaagagc ctgaaccagc ttcttcctct actgaagcgt tattaaagct gacacagagc       240
     gcaaattaca accgtgttgg tgcgagtgtg gttgatcgtc aaaacgaagc cattggtagc       300
     cttctcgata tccatatctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page