(data stored in SCRATCH zone)

EMBL: FM954973.PE460

FM954973.PE460       Location/Qualifiers
FT   CDS_pept        complement(525128..525586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0468"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25986"
FT                   /db_xref="GOA:B7VR83"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B7VR83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25986.1"
FT                   /translation="MNIDLLVNITLISTNFLILSFICFFDGWHRKIPNNLNKIALIFSH
FT                   LVALNNGYLMSSLPIAILCFVVFFILWYLKVIGGGDVKLLCALIISIQPNLVTITLICI
FT                   GFLGGLLVFAMYIVGKVRGLPSFTKGIPYGIPIALSCFFFSTISILAN"
     atgaatatag atttattagt taacattaca ttaatatcaa caaatttttt aatcctatcg        60
     tttatatgct tctttgatgg ttggcataga aaaatcccaa acaacctaaa taaaatagct       120
     ttgatattta gtcatctcgt cgcgttaaat aacggttact tgatgtcgtc actacccatt       180
     gcgattttat gtttcgtggt gttttttata ctttggtatc taaaagtgat aggaggtggt       240
     gatgtgaagt tactctgtgc cttaatcatt agcatacagc cgaatctagt tacaatcaca       300
     ttgatttgta taggtttttt aggcgggctt ttggttttcg ctatgtatat agtaggaaag       360
     gtaagaggat tacctagctt tacaaaaggc attccttacg gaatacctat tgctttgagc       420
     tgtttctttt ttagcactat atccatttta gcaaactga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page