(data stored in SCRATCH zone)

EMBL: FM954973.PE602

FM954973.PE602       Location/Qualifiers
FT   CDS_pept        complement(691396..691692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26236"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26236.1"
FT                   /translation="MLPAVRATDMHMRPMQTPDLVPTPHVSGPLLPLSTTVLIGNFPAA
FT                   TLGKICICVGPPDGVVKGSATVLVNNKPAARMGDLTVHVGTIIMGIPTVLIGG"
     atgctacctg ctgtaagagc cactgacatg catatgcgcc caatgcagac ccctgacctt        60
     gtccctactc ctcatgtaag tggaccgtta ctcccattgt ccacaacggt attgataggt       120
     aattttccag cagcaacgct ggggaaaata tgtatttgtg taggcccacc agacggtgtg       180
     gtaaaaggta gtgcgacagt gttagtcaat aataagcccg ctgccagaat gggtgatctt       240
     accgtacatg ttggcacaat tattatggga ataccaacgg tcttaatcgg aggttaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page