(data stored in SCRATCH zone)

EMBL: FM954973.PE639

FM954973.PE639       Location/Qualifiers
FT   CDS_pept        730057..730500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26304"
FT                   /db_xref="GOA:B7VRR2"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26304.1"
FT                   /translation="MFGVLLVLHVLAATIWTGGHIILSVVILPKVLKHRSPEMLLEFEQ
FT                   GYEKVGMPALVVQVVTGLMLAYHMLPDVSLWFDMSIPLAHGIAAKLTLLSLTVLLALDA
FT                   RFRVIPKLSKDNLVDMALHIVPVTIISILFVVVGVSFRTGWLV"
     atgtttggcg tattattggt tttgcatgta ttggctgcca ccatttggac gggagggcac        60
     attattctca gcgtcgttat ccttcctaaa gtcttgaaac accgttctcc agaaatgtta       120
     ttggaatttg agcaagggta cgaaaaggtg ggaatgcctg ctttggtagt tcaagtggtg       180
     accgggttga tgctcgctta tcacatgttg ccggacgtta gcttatggtt tgatatgtcg       240
     attccactgg ctcatggcat tgccgctaaa ttgacgttgt tgtctctgac ggtattgcta       300
     gccctagacg cacgctttcg tgtgattcca aaactatcga aggacaactt ggttgatatg       360
     gcgctgcata ttgtgccagt gaccattatt tcaattttgt ttgtggttgt cggagtttca       420
     tttagaacgg gttggctagt ttga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page