(data stored in SCRATCH zone)

EMBL: FM954973.PE647

FM954973.PE647       Location/Qualifiers
FT   CDS_pept        735583..738141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0668"
FT                   /product="Nitrite reductase [NAD(P)H] large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26319"
FT                   /db_xref="GOA:B7VRS0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26319.1"
FT                   /translation="MSKMKLVVIGNGMVGHRYIEDLVEKTDVANMDITVFCEEPRVAYD
FT                   RVHLSSYFSHHTADELSLVKEGFYEKHGINMLIGERAINVNREKKTVYSSTGREIQYDK
FT                   LVLATGSFPFVPPIKGHEGKDCFVYRTIEDLKAIEATAKNSKSGVVVGGGLLGLEAAGA
FT                   LKALGVTTHVVEFAPKLMAEQLDLAGGNQLRQKIERMGVNVHTSKNTLEIAPEGTEARN
FT                   VMRFADGTELETDFIVFSAGIRPQDKLARQMGLGIAPRGGIEINDHCQTTDKDIYAIGE
FT                   CASWNQTFYGLVAPGYKMATVAVDHVVGNESTFEGADMSAKLKLLGVKVGSIGDANGRT
FT                   PGCKSYVYQNEEQEIYKRLIVSEDNKKLLGAVMVGDTSDYGDLLQLMLNEIDLPEHPDA
FT                   LILPAHAGAEKPTLGADSLPESAVICSCFDVTKGKIAQAVAEGHHTIGDIKAVTGAGTG
FT                   CGGCIPLVTSVLNAELAKAGVEVKNDVCEHFAYSRQELFHLIRIEEIKTFDELLEKYGK
FT                   GYGCEVCKPLAGSILASCWGEHILKPELVKLHDTNDNFLGNIQKDGTYSVIPRMAGGEV
FT                   TPQALSVLADVAAEYNLYTKITGAQRIGLFGAQKDDLPAIWKKLVAAGYETGQAYAKAL
FT                   RMAKTCVGSTWCRYGVQDSVGLGVMIENRYKGIRTPHKMKFGVSGCTRECAEAQGKDLG
FT                   IIATDAGWNMYVCGNGGMKPRHADLLASDLDQETLIKYIDRFMMFYIRTAAPLQRTSVW
FT                   MDNLEGGVDYLREVIVDNKLGINDQLEADVAGLVGNFACEWTDTINDEAQLKRFSHFIN
FT                   ADDRDENVVFVDDGREQHRPATFTEKHPEAKGDILHVELV"
     atgagcaaga tgaagctagt cgtaatcggt aacgggatgg tcggtcatcg ctatatcgaa        60
     gatttagtcg agaagacaga tgttgcaaac atggacatca cggtgttctg tgaagaacca       120
     cgtgttgcgt atgaccgtgt gcacctttct tcttactttt cacaccatac tgcagatgaa       180
     ctttctttag taaaagaagg cttctacgag aaacacggca tcaacatgct gatcggtgaa       240
     cgtgctatca acgttaaccg tgaaaagaaa acagtttact caagcacagg tcgtgaaatt       300
     caatacgaca aacttgttct tgctactggt tctttcccgt ttgtaccgcc aattaaaggc       360
     cacgaaggta aagactgttt tgtttaccgt actatcgaag acttaaaagc tatcgaagcg       420
     acggcaaaga attctaaatc tggtgttgtt gttggtggtg gtctacttgg tcttgaagcg       480
     gctggtgcac taaaggcatt aggtgtgacg actcacgttg tagagtttgc tcccaagctt       540
     atggcagagc agcttgatct tgctggtggt aatcaacttc gtcaaaaaat cgaacgtatg       600
     ggcgtaaacg ttcatacaag taagaacacg cttgaaattg ctcctgaagg cactgaagct       660
     cgtaacgtaa tgcgttttgc agacggtaca gagctagaaa ctgatttcat cgtattctct       720
     gctggtattc gcccacaaga caaacttgct cgtcaaatgg gcctaggtat tgcgcctcgc       780
     ggtggtatcg agattaacga tcactgtcaa acgacagaca aagatatcta cgctatcggt       840
     gagtgtgcat cttggaacca aacgttctac ggcctagtgg ctcctggtta caaaatggcg       900
     acagtggcgg ttgaccacgt tgttggtaat gaaagcacat ttgaaggtgc tgacatgtct       960
     gcgaagctta agcttcttgg cgtgaaagta ggttctatcg gtgatgctaa cggccgcact      1020
     ccaggttgta agagctacgt ttaccaaaac gaagaacaag aaatttacaa gcgactaatc      1080
     gtttctgaag acaacaagaa gctgcttggc gcggtaatgg tcggtgatac gtctgactat      1140
     ggtgatcttc ttcagctaat gctgaatgaa atcgacctgc cagagcatcc agatgcattg      1200
     attcttcctg ctcacgcggg tgctgaaaag ccaacacttg gcgctgattc tcttcctgag      1260
     tctgctgtta tctgttcttg tttcgatgta actaaaggca agattgcaca agccgttgct      1320
     gaaggtcacc acaccattgg tgatatcaaa gcagtaactg gtgctggtac tggctgtggt      1380
     ggttgtattc cacttgtgac ttcagtactg aacgctgaac ttgctaaagc cggtgttgaa      1440
     gtgaagaacg acgtatgtga gcactttgct tactctcgcc aagagctttt ccacttgatt      1500
     cgtatcgaag aaatcaaaac attcgatgag ttactagaga aatacggtaa aggctacggc      1560
     tgtgaagtat gtaagcctct agcgggttct attcttgctt cttgctgggg tgagcacatc      1620
     cttaagcctg agctagtgaa actgcatgat accaacgata acttcctagg taacatccaa      1680
     aaagacggta cttactctgt tatccctcgt atggcaggtg gtgaagtaac gcctcaagca      1740
     ctaagcgttc ttgctgatgt agcggctgaa tacaaccttt acaccaagat cacaggtgct      1800
     cagcgtatcg gtctattcgg tgctcaaaaa gatgacttac cagcaatctg gaagaagtta      1860
     gttgctgcgg gctacgaaac aggtcaagcg tacgcgaagg cgctacgtat ggctaagaca      1920
     tgtgtcggtt caacttggtg tcgttacggc gttcaagatt cagttggcct aggtgtgatg      1980
     atcgagaacc gttacaaagg catccgtact cctcataaga tgaagtttgg tgtgtctggc      2040
     tgtactcgtg agtgtgctga agctcaaggt aaagacttag gtattatcgc gactgacgca      2100
     ggttggaaca tgtacgtatg tggtaacggt ggtatgaagc ctcgtcacgc agacttactt      2160
     gcaagcgacc tagaccaaga aacgctgatc aaatacatcg accgtttcat gatgttctac      2220
     atccgcacgg ctgcgccact acaacgtact tcggtatgga tggacaacct agagggtggt      2280
     gttgactacc tacgtgaagt gattgtcgac aacaagcttg gcatcaatga ccaacttgaa      2340
     gcggacgtag ctggccttgt gggtaacttt gcttgtgagt ggactgacac tatcaacgac      2400
     gaagctcaac ttaagcgctt ctcacacttc atcaatgctg acgaccgtga tgaaaacgtt      2460
     gtgtttgttg acgatggccg tgaacaacac cgcccagcaa cattcacaga aaaacaccca      2520
     gaagcgaagg gcgatatcct tcacgttgaa ctggtttaa                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page