(data stored in SCRATCH zone)

EMBL: FM954973.PE657

FM954973.PE657       Location/Qualifiers
FT   CDS_pept        748363..749130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0678"
FT                   /db_xref="EnsemblGenomes-Tr:CAV26338"
FT                   /db_xref="InterPro:IPR016866"
FT                   /db_xref="UniProtKB/TrEMBL:B7VRT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV26338.1"
FT                   /translation="MNLLKTSLALAISLVATSSMANSLDQAQSIQNKTNNASASSQKVI
FT                   DKSSQATLLLQAEVERLQEEVKNLEIYHDHLAALVKSQDQEALSIEGQIDEIKLTRQGV
FT                   VPLMYKMIDGLQEVIESDLPFKKNSRLRRVEKLKAMMTRADVSDAEKYRRILEAYQIEV
FT                   DYGIKLSSYSSRVELSQDKVLEVDVLHLGRISLVARNLNGTQYWSWDQNSAQWQELDSS
FT                   MKSELDKAYDIANKQASPSLITLPVSLTVAEVK"
     atgaatcttt taaaaactag cctagcactt gccatcagtt tggttgcaac gtcatcgatg        60
     gcaaacagct tggatcaagc tcaatcaatt caaaacaaga ccaataacgc gtcggcttcg       120
     agccaaaagg ttattgataa aagctcacaa gcaacattat tgctgcaagc tgaggttgag       180
     cgtctgcaag aagaagtgaa aaatttagaa atctatcacg atcatcttgc cgcattggtt       240
     aagagccaag atcaagaagc gctgagtatt gaagggcaga tcgacgaaat caaactaaca       300
     cgtcaaggtg tagtgccttt gatgtacaag atgatcgatg gtctccaaga agttattgaa       360
     agcgatctac ctttcaagaa aaatagccgt ctgcgtcgcg ttgaaaagct gaaagcgatg       420
     atgactcgtg ctgatgtcag tgatgctgaa aaatatcgcc gtattttaga ggcgtaccaa       480
     attgaagtgg attacggtat taagctaagt tcttattcaa gccgtgtcga gttaagtcaa       540
     gataaagtgc ttgaagttga tgttttgcat cttggccgca tttcactggt cgctcgtaac       600
     ttaaatggta ctcaatattg gtcttgggac caaaatagtg ctcaatggca agagttggat       660
     tcttccatga aatctgagtt ggacaaagcg tacgatattg ctaataagca agcatctcca       720
     agcttaatca ctttacctgt ttctttaact gttgcggagg ttaagtaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page