(data stored in SCRATCH zone)

EMBL: FM954973.PE75

FM954973.PE75        Location/Qualifiers
FT   CDS_pept        complement(90441..91505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VS_II0078"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VS_II0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAV25313"
FT                   /db_xref="GOA:B7VQ48"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B7VQ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAV25313.1"
FT                   /translation="MYVASLSTLIQNNDLEQLMSDTQRKIKWGIAGLGNIANRFATAVI
FT                   EHCLHGELYAVAARDHSRAATFANKFGCDKAYGSYEKMAQDPDVEAVYIATVHPYHKPL
FT                   AELFLSHKKHVLVEKPAFTNLGDWLEMKALANQNGVMLLEAMKTVVFPAYREIQSFLVD
FT                   NNIQIDSIEASFGNHHDYEPGLFIFNPDLSGGATLDVGVYGLWFFYDLCRTLGVTPSEP
FT                   QVEMSCLYEGANVDTDACFTFSGDMNGKISASTVQNLPRTAHLTGPDTKITIHEKWWNP
FT                   AFIEIEHQGQKSTINCRVTGNGFEFEIDHFSGLVLQDKTESDILSSEITSRVLDTMEKA
FT                   LIDSGYPHLTQPRR"
     ttgtatgtgg cgtctctgag tacactgata caaaacaacg atttggagca actgatgagc        60
     gacacgcaac gtaaaattaa atggggtatc gctgggctag gcaatatcgc caatcgattc       120
     gcaacagctg taatcgagca ctgtctgcat ggtgaattgt atgccgttgc cgcaagagat       180
     cactcacgcg cagctacgtt cgccaataag tttggttgcg acaaggctta tggatcttat       240
     gaaaagatgg cgcaagatcc agatgttgaa gcggtttaca tcgctacggt tcatccttat       300
     cacaagcctt tagctgaact gtttctaagc cataaaaaac atgtattggt cgagaagccg       360
     gctttcacta atcttggtga ttggctggag atgaaagctc tcgcaaatca aaatggtgtg       420
     atgttgctag aagcaatgaa aaccgtggtg tttcccgcgt atcgtgagat ccaatcattc       480
     ttggtcgaca acaacattca gatagattca atcgaagcca gctttggtaa ccatcacgac       540
     tatgagccgg gcttatttat cttcaatccg gatttgtcag gcggagcaac gcttgatgtt       600
     ggggtctatg ggctttggtt cttttacgat ctgtgcagaa cactgggggt gaccccttca       660
     gaacctcagg tagagatgtc gtgtctgtat gagggcgcga atgtcgatac cgatgcgtgc       720
     tttacattct ctggtgatat gaacggtaag atatcggcat caacagtgca gaaccttccc       780
     cgaacggcac acttgactgg gcctgatacc aaaatcacca ttcacgaaaa atggtggaat       840
     ccagccttta ttgagattga acatcaaggg caaaagtcga ccatcaactg ccgagtgacg       900
     gggaatgggt tcgaatttga aatcgaccat ttttcaggat tggtgcttca agataaaact       960
     gagtcggata tcctaagctc agagataacc tctcgagttc tcgatacgat ggaaaaagca      1020
     ctgattgact ctggctatcc acatttaact caacctcgtc gttag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page