(data stored in ACNUC8465 zone)

EMBL: FN543502.AATA

FN543502.AATA        Location/Qualifiers
FT   CDS_pept        375174..376382
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="ROD_03461"
FT                   /product="AatA, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03461"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87128"
FT                   /db_xref="GOA:D2TJZ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ8"
FT                   /protein_id="CBG87128.1"
FT                   /translation="MRFNKKYMVIILANLLVGKDVFSCSLNMYLSKLESYELFKLEQED
FT                   SLLQNKSVASSFLPNVSIGMGQYINNNTGLVDIGRSSFYIAASQLIFSGESLGKNSEKE
FT                   ENDNKRRIISFEKDKNEQLLKLYADILQYKYLKENISLILRRLDKLKLEYNKTVLDLKS
FT                   GIIPSLEVDVKSLNVLKMESSLNRLKADYELLENKINKNYSIPPQNISKITENDILSCK
FT                   TISYRELIDKNKHNKLQQADIELDINNASLLPSIYLSIGLTPKNEGALRDINLREMNYN
FT                   GGISVNFPINNIFSAIDNQKKYAISVTKARLESERDHEQLLIANRNILNEYLAIKRNIP
FT                   ILKKEVQLKNRRMEYKLWLVKEKKENILSYLDSQDELYEAEINLKKNERDLKYYQMYLN
FT                   FIN"
     atgagattta acaagaaata tatggtgatt atattggcta acttattagt gggaaaagat        60
     gttttctcat gtagtttgaa tatgtattta agcaaattag aaagttatga gctcttcaaa       120
     ttggaacagg aagacagcct attacaaaac aagtccgttg cttcttcttt tttgccaaac       180
     gtatctattg gcatggggca atacattaat aataatactg gtttagtaga tattggacga       240
     agctcatttt atatagctgc ttcacaactt atattctctg gcgaaagttt agggaagaat       300
     agtgagaaag aagagaatga taataaaaga agaataatat cctttgaaaa ggataaaaat       360
     gaacaattgt tgaaattata tgctgatata ttacaatata aatatctaaa agaaaatata       420
     tcattgattt taaggagact ggataagctt aaattagaat ataacaagac agtgttggat       480
     ttaaaatctg gaattatccc atcacttgaa gttgatgtta aatcattgaa tgttttaaag       540
     atggaaagct cattgaatag gctgaaagcg gattatgagt tactcgaaaa taaaatcaat       600
     aagaactact caataccacc tcaaaacata tctaaaatta cagaaaatga cattttatca       660
     tgtaaaacaa ttagctatcg ggagctaatt gataaaaaca aacataataa attacagcag       720
     gctgatatcg aacttgatat caataatgct tcactattgc catcaatata cctatcaata       780
     ggactaactc ctaaaaatga aggtgctctc agagatataa atcttaggga aatgaactat       840
     aatggaggaa taagtgttaa ttttcctata aacaatattt ttagtgccat cgacaatcaa       900
     aaaaaatatg ctattagtgt gactaaagca agattggaat cagaaaggga tcatgaacag       960
     cttctcattg caaatcgaaa tatacttaat gagtacttag ccattaaaag aaatataccc      1020
     attttaaaaa aagaagttca attaaagaat agaagaatgg agtataaact atggctggtt      1080
     aaagaaaaaa aagaaaatat actgtcatat cttgactctc aggatgaatt atatgaagca      1140
     gaaattaatc ttaaaaaaaa tgaacgtgat cttaaatatt atcagatgta tcttaatttt      1200
     attaattaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page