(data stored in ACNUC8465 zone)

EMBL: FN543502.ACPH

FN543502.ACPH        Location/Qualifiers
FT   CDS_pept        complement(506953..507534)
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="ROD_04521"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04521"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87231"
FT                   /db_xref="GOA:D2TKZ0"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ0"
FT                   /protein_id="CBG87231.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPETHFPPEVVEGILMH
FT                   RRIDVLTDNLPEVREAREWFRRETRRVAPITLDVMWDHFLSRHWAQISPDFPLPAFVGY
FT                   ARTQIATILPDSPPRFVNLNHHLWSEQWLERYRDMAFIQNVLNGMASRRPRLEALRDSW
FT                   HDLDRHYDALEERFWRFYPQMMDQARQKTL"
     atgaattttt tagctcacct gcatctggct catcttgctg acagttcgct ttccggcaat        60
     ctgctggccg attttgtccg ggggaacccg gaaacgcact ttccgcccga ggtggtggaa       120
     ggcattctga tgcaccggcg catcgacgtg ctgaccgata atctgccgga agttcgcgaa       180
     gcgcgggagt ggtttcgtcg cgaaacgcgc cgcgtggcgc ccatcaccct ggacgtgatg       240
     tgggatcact ttctgtcgcg ccactgggcg cagatttcac cagacttccc gcttccggcg       300
     tttgtcggct acgcccgcac ccagatcgcc accatcctgc ccgattcgcc gccgcgtttt       360
     gtcaatctta atcatcatct gtggtcggaa cagtggctgg agcgctatcg cgatatggca       420
     tttatacaga atgtcctgaa cggcatggcc agccgccgcc cgcgccttga ggcgctgcgc       480
     gactcctggc atgacctgga ccgccattat gacgcgctgg aagaacgctt ctggcgcttt       540
     tatccgcaga tgatggacca ggcgcgacag aaaacgctct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page