(data stored in ACNUC8465 zone)

EMBL: FN543502.ARAJ

FN543502.ARAJ        Location/Qualifiers
FT   CDS_pept        complement(487320..488468)
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="ROD_04391"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04391"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87219"
FT                   /db_xref="GOA:D2TKX8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX8"
FT                   /protein_id="CBG87219.1"
FT                   /translation="MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMIS
FT                   YYALGVVVGAPVIALLSGRFSLKRILLFLVTLCVIGNAMFTLSSSYPMLAIGRLVSGFP
FT                   HGAFFGVGAIILSKLVRPGKVTAAVAGMVAGMTVANLIGIPLGTFLSHQFSWRYTFLLI
FT                   AVFNIAVIVSILLWVPDLRDERKGKLREQFHFLKSPAPWLIFAATLTGNAGVFAWFSYI
FT                   KPYMIFVSGFPETVMTFIMMLVGLGMVLGNLLSGRLSGRFSPLAIAATTDFVIVLCLLL
FT                   LFFVGGYRVASLTVAFICCAGLFALSAPLQILLLQNARGGELLGAAGGQIAFNLGSAIG
FT                   AYCGGMMLTLGFACNYVALPAALLSFTAMASLLIYGRIQDRQ"
     atgaaaaagg ttattttctc tttagcgctg ggcaccttcg ggctcggcat ggccgaattc        60
     ggcattatgg gcgtcttaac ggaactggcg cgcgacgttg gcatcacaat ccccgccgcc       120
     gggcatatga tttcgtatta cgcgcttggc gtggtggtgg gcgcgccggt tatcgccctg       180
     ctctccggcc gcttttccct gaaacgtatt ctgctgtttc tggtgacgtt gtgcgttatc       240
     ggcaacgcca tgtttaccct ctcttcgtcc tatcccatgc tggcgatcgg caggctggtt       300
     tccggctttc cgcatggcgc tttttttggc gtgggggcaa ttattttgtc gaaactggta       360
     cgccccggaa aagtcaccgc cgccgtggcg gggatggtcg ccggtatgac cgtggcgaac       420
     ctgatcggca ttccgctcgg caccttcctc agccaccagt tcagctggcg ctataccttt       480
     ctgctgattg ccgtctttaa tatcgcggtg atcgtctcga ttctgttgtg ggtgccggat       540
     ctgcgcgacg aaagaaaggg aaagctgcgc gagcagttcc attttctcaa aagcccggcg       600
     ccgtggctga tttttgccgc caccctcacc ggtaacgccg gcgttttcgc gtggttcagc       660
     tacataaagc catacatgat tttcgtctcc ggcttcccgg aaacggtcat gacgttcatt       720
     atgatgctgg tcggcctggg aatggtgctg ggaaacctgc tcagcgggcg gctgtccggt       780
     cgtttctccc cgctcgccat cgccgcaacc accgattttg tcatcgtcct gtgcctgctg       840
     ctgctctttt tcgtcggcgg ctaccgggtc gcctcgctga ccgtcgcctt tatctgctgc       900
     gcggggctgt tcgccctttc cgcgccgctg cagatcctgc tgctgcaaaa cgccagaggc       960
     ggcgagctgc tgggcgcagc gggcggccaa atcgcgttta atctcggcag cgccattggc      1020
     gcctattgcg gcggaatgat gctgacgttg ggctttgcct gtaactacgt ggcgctgccc      1080
     gccgccctgc tgtcgtttac cgccatggcg tcattgctca tctacgggcg tattcaggac      1140
     agacagtag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page