(data stored in ACNUC8465 zone)

EMBL: FN543502.BRNQ

FN543502.BRNQ        Location/Qualifiers
FT   CDS_pept        497023..498342
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ROD_04451"
FT                   /product="branched chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04451"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87225"
FT                   /db_xref="GOA:D2TKY4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY4"
FT                   /protein_id="CBG87225.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLFIYSVIYFALVILVSLYPGKLLDTVGNFLAPLKIIALIVLS
FT                   VAAIIWPAGPISHAMEAYENAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTESR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSVNGAAILHAYVQHTFGGAGSL
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRSLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPAMFISLLFGILDGIKASAIGDVLPAW
FT                   TQRLPLAEQGLAWLIPTVVIVVLAIIWDRAAGRQVTSGAH"
     atgacccatc agttgaaatc gcgcgatatt atcgcccttg gctttatgac ttttgcgctg        60
     tttgtcggcg caggaaacat tatctttcca ccaatggtcg gtctgcaggc gggcgagcac       120
     gtctggactg cggctttcgg ctttctgatt accgcggtgg gcctgccggt actaaccgtg       180
     gtggcgctgg cgaaagtcgg cggcggcgtg gacagcctga gcaccccgat tggtaaagtg       240
     gcgggcgtcc tgctggcgac cgtctgctat ctggcggtcg ggccgctgtt cgccacgccg       300
     cgtaccgcca ccgtctcctt tgaagtgggc atcgccccgc tgaccggcga ctcggccatg       360
     ccgctgttta tctacagcgt gatctacttt gcgctggtca ttctggtgtc gctctatccg       420
     ggcaaattac tggataccgt cggcaacttc ctggcgccgc tgaaaattat cgccctgatc       480
     gtactgtccg tggccgccat tatctggccg gcgggaccga tcagccacgc gatggaagct       540
     tatgaaaacg cggcgttctc caacggcttt gtcaacggct atctgacgat ggatacgctg       600
     ggcgcgatgg tgtttgggat cgtgattgtt aacgccgcgc gttctcgcgg cgtgaccgag       660
     tcacgtctgc tgacccgtta taccgtctgg gcgggtctga tggcgggcgt tggcctgacg       720
     ctgctctatc tggcgctgtt ccgtctgggt tcagatagcg cgacgctggt cgatcagtcc       780
     gttaacggcg cggcgatcct ccacgcttac gtgcagcaca cctttggcgg ggcgggcagc       840
     ctgctgctgg cggcgctgat cttcatcgcc tgcctggtga cggcggtcgg cctgacctgc       900
     gcctgcgcgg agtttttcgc gcagtacgta ccgctctctt atcgctcgct ggtgtttatc       960
     ctcggcgggt tctcaatggt ggtttccaac ctggggctga gtcacctgat ccagatctct      1020
     atcccggtgc tgacggcgat ttatccgccg tgtatcgcac tggtggtatt aagttttacc      1080
     cgctcatggt ggcataattc gtcccgcgtt atcgcaccgg cgatgtttat cagcctgctt      1140
     tttggtatcc ttgacgggat taaagcatcg gcaatcggcg acgtgttacc ggcctggacg      1200
     cagcgtttac cgctggcgga gcaggggctg gcgtggttaa ttcccaccgt cgtgatagtg      1260
     gtcctggcga ttatctggga tcgcgccgcg ggtcggcagg tgacctccgg cgctcactaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page