(data stored in ACNUC8465 zone)

EMBL: FN543502.BTUF

FN543502.BTUF        Location/Qualifiers
FT   CDS_pept        complement(193672..194472)
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ROD_01621"
FT                   /product="vitamin B12-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01621"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86942"
FT                   /db_xref="GOA:D2TI46"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:D2TI46"
FT                   /protein_id="CBG86942.1"
FT                   /translation="MANSLSRALAALLLWLPVSLCAAPRVITLSPANTELAFAAGITPV
FT                   AVSSYSDYPPAARDIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVNQLTSLGIRV
FT                   MWVDAASIEQIAQTLRKLAAWSPQPEKAQHAARRLLDDYQQLKSEYADRSKKRLFLQFG
FT                   INPPFTSAKGSIQNEVLELCGGENIFADSRVPWPQVSREQVLARAPQAIVVAGNAEETL
FT                   KIKQYWGNQLKIPVIPLTSDWFERASPRIILAAKQLCTALSQVN"
     atggctaact ctctctccag ggcgcttgcc gccctgctgt tatggctccc ggtgtcgctc        60
     tgcgccgcac cgcgcgtgat taccctctct cccgccaata ccgaactcgc ctttgccgct       120
     ggcattacgc ccgtcgcggt cagcagctat tctgactacc cgcccgcagc gcgagacatt       180
     gagcaggtgt caacctggca gggcatgaac ctggagcgca ttgtggcgct gaagccggat       240
     ctggtcatcg cctggcgcgg cggcaacgcg gaacggcagg ttaatcaact cacctcgtta       300
     ggcatcaggg tgatgtgggt ggatgccgcc agcattgagc aaatcgcgca aacgctgcgc       360
     aaactggccg cctggagtcc gcagccggaa aaggcgcagc atgccgcccg gcgcctgctg       420
     gacgattacc agcagttaaa atctgagtac gcggacagaa gcaaaaagcg tctgtttttg       480
     cagtttggca tcaatcctcc cttcaccagc gcaaaaggat cgattcaaaa tgaagtgctg       540
     gagctgtgcg gcggggaaaa catctttgcc gacagtcggg ttccctggcc gcaggtaagc       600
     cgcgaacagg tgctggcccg cgctccgcag gcgatcgtcg tcgccggtaa tgcggaggaa       660
     actctcaaaa ttaaacaata ctggggtaat cagctaaaaa ttccggttat tccccttacc       720
     agtgactggt ttgaacgcgc aagcccgcgt attatcctcg ccgcaaaaca actctgcact       780
     gcgctttcac aggtgaatta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page