(data stored in ACNUC8465 zone)

EMBL: FN543502.CI

FN543502.CI          Location/Qualifiers
FT   CDS_pept        325039..325686
FT                   /transl_table=11
FT                   /gene="cI"
FT                   /locus_tag="ROD_02941"
FT                   /product="putative phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_02941"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87078"
FT                   /db_xref="GOA:D2TJ73"
FT                   /db_xref="InterPro:IPR010744"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJ73"
FT                   /protein_id="CBG87078.1"
FT                   /translation="MTRNDDAFSFVDRGKESFRERLVKLIGNRSVRTAASDWGIPPSTL
FT                   NNYIHKGTEPSFKIACLISDKEQVSLNWLAYGEEPTAKEGSLSNQTAQPSPDITNELVN
FT                   ELLKRASTEVKEQLISAICDMGIKGILERLQQPTKQTKQADSDLDELENAIRRLNIRES
FT                   LKDTICMALAGNEETDKEILRRIESRIRAGSPGGHTVATPEQETKPVSKKSA"
     atgaccagaa atgatgatgc tttttctttt gtcgaccggg gaaaagaaag tttcagagag        60
     cgtttagtaa agctgatagg taaccgcagt gtcagaactg ctgcgagtga ttggggaatc       120
     cccccttcaa ccttaaacaa ctacattcat aaaggaacag agccttcttt taaaatagct       180
     tgccttatct cagataaaga gcaagtgagc ttaaattggc tcgcttacgg tgaagaaccc       240
     accgccaaag aaggttctct atcaaatcaa acagcgcagc cttctcccga tattacaaac       300
     gagctagtta acgagttatt gaaaagagcg tccacagaag ttaaggagca actgataagt       360
     gcaatatgcg atatgggcat taaaggaatc ttggaacgcc tacagcaacc caccaagcaa       420
     actaagcagg ccgacagcga cttggatgaa ctggagaatg ccatcagaag attaaacatc       480
     agggaatcgc ttaaagacac tatttgcatg gcattggctg gtaatgaaga aactgacaaa       540
     gagattttgc gccgtatcga atctcgtata cgagctgggt cgccaggtgg tcataccgtt       600
     gccacgccgg agcaagaaac gaagcctgta agcaaaaaat cagcatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page